anti-Human FGF5 Antikörper für Immunofluorescence

Recommended FGF5 Antibody (geliefert von: Anmelden zum Anzeigen )

Fibroblast Growth Factor 5 (FGF5) Antikörper
  • FGF5
  • HBGF-5
  • Smag-82
  • Fgf-5
  • angora
  • go
  • FGF-5
  • fibroblast growth factor 5
  • FGF5
  • fgf5
  • Fgf5
Dieser FGF5 Antikörper ist unkonjugiert
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN5076782
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
11.690664 ABIN515610 IF WB Mouse AA 1-123, full length Anmelden zum Anzeigen Polyclonal
1 ABIN2602007 IF WB Mouse IgG AA 1-123 Anmelden zum Anzeigen Polyclonal
1 ABIN2266574 IF WB Mouse IgG AA 1-123 Anmelden zum Anzeigen Polyclonal
1 ABIN3059902 ICC IF IP IHC WB Rabbit Anmelden zum Anzeigen Polyclonal


Antigen Fibroblast Growth Factor 5 (FGF5) Antikörper
Reaktivität Human
(87), (18), (16), (4)
Wirt Kaninchen
(37), (33), (17)
Konjugat Dieser FGF5 Antikörper ist unkonjugiert
(4), (4), (4), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
(59), (38), (21), (21), (13), (7), (4), (3), (3), (2), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-FGF5 Antikörper

Target Details FGF5 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG
Isotyp IgG

Target Details FGF5

Produktdetails anti-FGF5 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung FGF-5 (FGF5 Antibody Abstract)
Hintergrund Gene Symbol: FGF5
Gen-ID 2250
Pathways RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung


Produktdetails anti-FGF5 Antikörper Target Details FGF5 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-FGF5 Antikörper Target Details FGF5 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-FGF5 Antikörper Target Details FGF5 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Fibroblast Growth Factor 5 (FGF5) antibody (ABIN5076782) Immunocytochemistry/Immunofluorescence: FGF-5 Antibody - Staining of human cell line...
Western Blotting (WB) image for anti-Fibroblast Growth Factor 5 (FGF5) antibody (ABIN5076782) Western Blot: FGF-5 Antibody - Western blot analysis in human cell line RT-4, human ...