anti-Pferd ERBB3 Antikörper für Immunohistochemistry

Recommended ERBB3 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
V-Erb-B2 Erythroblastic Leukemia Viral Oncogene Homolog 3 (Avian) (ERBB3) Antikörper
  • ERBB3
  • ErbB-3
  • HER3
  • LCCS2
  • MDA-BF-1
  • c-erbB-3
  • c-erbB3
  • erbB3-S
  • p180-ErbB3
  • p45-sErbB3
  • p85-sErbB3
  • nuc-ErbB3
  • C76256
  • Erbb-3
  • Erbb3r
  • Her3
  • v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)
  • v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3
  • ERBB3
  • Erbb3
Reaktivität
Rind (Kuh), Meerschweinchen, Pferd, Human, Maus, Ratte (Rattus)
535
198
172
13
7
6
6
3
3
3
2
2
2
2
2
1
1
Wirt
Kaninchen
302
230
28
4
Klonalität
Polyklonal
Konjugat
Dieser ERBB3 Antikörper ist unkonjugiert
14
13
12
11
11
11
8
8
8
8
7
6
6
5
5
5
5
5
5
4
3
3
3
3
3
3
3
3
2
Applikation
Immunohistochemistry (IHC)
314
194
148
128
107
84
67
57
11
11
10
8
8
7
4
4
3
2
2
2
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN2779309
$ 289.00
Zzgl. Versandkosten $45.00

General

Antigen V-Erb-B2 Erythroblastic Leukemia Viral Oncogene Homolog 3 (Avian) (ERBB3) Antikörper
Reaktivität Rind (Kuh), Meerschweinchen, Pferd, Human, Maus, Ratte (Rattus)
(535), (198), (172), (13), (7), (6), (6), (3), (3), (3), (2), (2), (2), (2), (2), (1), (1)
Wirt Kaninchen
(302), (230), (28), (4)
Klonalität
Polyklonal
Konjugat Dieser ERBB3 Antikörper ist unkonjugiert
(14), (13), (12), (11), (11), (11), (8), (8), (8), (8), (7), (6), (6), (5), (5), (5), (5), (5), (5), (4), (3), (3), (3), (3), (3), (3), (3), (3), (2)
Applikation Immunohistochemistry (IHC)
(314), (194), (148), (128), (107), (84), (67), (57), (11), (11), (10), (8), (8), (7), (4), (4), (3), (2), (2), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-ERBB3 Antikörper

Target Details ERBB3 Anwendungsinformationen Handhabung Bilder
Sequenz GLLFSLARGS EVGNSQAVCP GTLNGLSVTG DAENQYQTLY KLYERCEVVM
Homologie Cow: 92%, Guinea Pig: 100%, Horse: 92%, Human: 100%, Mouse: 92%, Rat: 92%
Reinigung Affinity Purified
Immunogen The immunogen is a synthetic peptide directed towards the following sequence GLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM

Target Details ERBB3

Produktdetails anti-ERBB3 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung ERBB3 (ERBB3 Antibody Abstract)
Hintergrund This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized.
Alias Symbols: HER3, LCCS2, ErbB-3, c-erbB3, erbB3-S, MDA-BF-1, c-erbB-3, p180-ErbB3, p45-sErbB3, p85-sErbB3,
Protein Interaction Partner: PA2G4, UBC, NEDD4, JAK3, JAK2, ITK, HSP90AA1, HCK, GRB7, FGFR1, FER, PIK3R2, PIK3R1, NCK1, SH2D1A, TNS4, TNS3, SHC3, DAPP1, TENC1, VAV3, SH2B3, RIN1, PIK3R3, NCK2, BCAR3, ZAP70, VAV2, VAV1, TXK, SYK, SRC, SHC1, RASA1, PTK6, PLCG1, DAB1, CRKL, CRK, CHN2, A
Protein Size: 1342
Molekulargewicht 148 kDa
Gen-ID 2065
NCBI Accession NM_001005915, NP_001973
UniProt P21860
Forschungsgebiet Receptors, Growth Factors, Cytokines
Pathways RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung

Anwendungsinformationen

Produktdetails anti-ERBB3 Antikörper Target Details ERBB3 Handhabung Bilder zurück nach oben
Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-ERBB3 Antikörper Target Details ERBB3 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Konzentration 1 mg/mL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeat freeze-thaw cycles.
Lagerung -20 °C
Informationen zur Lagerung For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Bilder

Produktdetails anti-ERBB3 Antikörper Target Details ERBB3 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-V-Erb-B2 Erythroblastic Leukemia Viral Oncogene Homolog 3 (Avian) (ERBB3) antibody (ABIN2779309) anti-V-Erb-B2 Erythroblastic Leukemia Viral Oncogene Homolog 3 (Avian) (ERBB3) antibody
Immunohistochemistry (IHC) image for anti-V-Erb-B2 Erythroblastic Leukemia Viral Oncogene Homolog 3 (Avian) (ERBB3) antibody (ABIN2779309) anti-V-Erb-B2 Erythroblastic Leukemia Viral Oncogene Homolog 3 (Avian) (ERBB3) antibody (Image 2)