anti-Maus Macrophage Inflammatory Protein Related Protein 1 Antikörper für Immunocytochemistry

Recommended Macrophage Inflammatory Protein Related Protein 1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Macrophage Inflammatory Protein Related Protein 1 (MRP1) Antikörper
  • Abcc1a
  • Avcc1a
  • Mrp
  • Mrp1
  • BTCC-1
  • DRAP-27
  • MIC3
  • MRP-1
  • TSPAN-29
  • TSPAN29
  • Scya6
  • c10
  • ATP-binding cassette, subfamily C (CFTR/MRP), member 1
  • CD9 molecule
  • chemokine (C-C motif) ligand 6
  • Abcc1
  • CD9
  • Ccl6
Epitop
N-Term, AA 1-33
15
9
7
4
2
2
2
2
1
Reaktivität
Human, Maus
82
48
48
1
Wirt
Maus
55
27
8
Klonalität
Monoklonal
Konjugat
Unkonjugiert
5
5
5
4
4
4
4
4
4
4
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
52
46
32
24
24
16
13
8
8
3
3
3
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN189465
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN268892 CyTOF ELISA FACS ICC IF IP WB Mouse IgG1 Anmelden zum Anzeigen IU2H10 10
1 ABIN1859882 ICC IHC IP WB Rabbit IgG AA 22-116 Anmelden zum Anzeigen Polyclonal
1 ABIN4335458 ELISA FACS ICC IF WB DyLight 405 Mouse IgG1 Anmelden zum Anzeigen IU2H10
1 ABIN4232806 ELISA FACS ICC IF FITC Mouse IgG1 Anmelden zum Anzeigen IU2H10
1 ABIN4232807 ELISA FACS ICC IF WB DyLight 680 Mouse IgG1 Anmelden zum Anzeigen IU2H10
1 ABIN4232811 ELISA FACS ICC IF WB DyLight 350 Mouse IgG1 Anmelden zum Anzeigen IU2H10
1 ABIN4232809 ICC IF WB PerCP Mouse IgG1 Anmelden zum Anzeigen IU2H10
1 ABIN4232808 ELISA FACS ICC IF WB DyLight 755 Mouse IgG1 Anmelden zum Anzeigen IU2H10
1 ABIN4335469 ELISA FACS ICC IF WB Alexa Fluor 647 Mouse IgG1 Anmelden zum Anzeigen IU2H10
1 ABIN4335470 ELISA FACS ICC IF WB Alexa Fluor 700 Mouse IgG1 Anmelden zum Anzeigen IU2H10
1 ABIN4335467 ELISA FACS ICC IF WB Alexa Fluor 405 Mouse IgG1 Anmelden zum Anzeigen IU2H10
1 ABIN4335455 ELISA FACS ICC IF WB DyLight 550 Mouse IgG1 Anmelden zum Anzeigen IU2H10
1 ABIN4335454 ELISA FACS ICC IF WB DyLight 650 Mouse IgG1 Anmelden zum Anzeigen IU2H10
1 ABIN4335456 CyTOF ELISA FACS ICC IF IP WB Mouse IgG1 Anmelden zum Anzeigen IU2H10
1 ABIN4335468 ELISA FACS ICC IF WB Alexa Fluor 488 Mouse IgG1 Anmelden zum Anzeigen IU2H10
1 ABIN446291 CyTOF ELISA FACS ICC IF IP WB Mouse IgG1 Anmelden zum Anzeigen IU2H10
1 ABIN438211 ELISA ICC IF WB Biotin Mouse IgG1 Anmelden zum Anzeigen IU2H10
1 ABIN438213 ELISA FACS ICC IF WB DyLight 488 Mouse IgG1 Anmelden zum Anzeigen IU2H10
1 ABIN1722154 ICC IF WB DyLight 650 Mouse IgG1 AA 1-33 Anmelden zum Anzeigen IU2H10
1 ABIN1722157 ICC IF WB DyLight 550 Mouse IgG1 AA 1-33 Anmelden zum Anzeigen IU2H10

General

Antigen Macrophage Inflammatory Protein Related Protein 1 (MRP1) Antikörper
Epitop N-Term, AA 1-33
(15), (9), (7), (4), (2), (2), (2), (2), (1)
Reaktivität Human, Maus
(82), (48), (48), (1)
Wirt Maus
(55), (27), (8)
Klonalität (Klon)
Monoklonal   ( )
Konjugat Unkonjugiert
(5), (5), (5), (4), (4), (4), (4), (4), (4), (4), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
(52), (46), (32), (24), (24), (16), (13), (8), (8), (3), (3), (3), (2), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Referenzen Bilder
Reinigung Unpurified
Immunogen A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527]
Klon IU5C1
Isotyp IgG1

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Referenzen Bilder zurück nach oben
Antigen
Andere Bezeichnung MRP1 (MRP1 Antibody Abstract)
Hintergrund Gene Symbol: ABCC1
Molekulargewicht Theoretical MW: 172 kDa
Gen-ID 4363
UniProt P33527
Forschungsgebiet Atherosclerosis, Metabolism, Cancer
Pathways Response to Water Deprivation, Cell-Cell Junction Organization

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Referenzen Bilder zurück nach oben
Applikationshinweise Western Blot 1:250-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:2000This MRP1 antibody is useful for Immunocytochemistry/Immunofluorescence and Western blot analysis on transfected lysate, where a band is seen at ~172 kDa. The use of this antibody in ICC/IF was reported in literature. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Referenzen Bilder zurück nach oben
Format Liquid
Buffer Ascites
Buffer contains: 0.1 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid freeze-thaw cycles
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.

Referenzen

Produktdetails Antigendetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Chen, Yang, Li, Zhang: "The amino terminus of the human multidrug resistance transporter ABCC1 has a U-shaped folding with a gating function." in: The Journal of biological chemistry, Vol. 281, Issue 41, pp. 31152-63, 2006 (Probematerial (Species): Human). Weitere Details: Immunocytochemistry,Immunofluorescence

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung Referenzen zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Macrophage Inflammatory Protein Related Protein 1 (MRP1) (AA 1-33), (N-Term) antibody (ABIN189465) anti-Macrophage Inflammatory Protein Related Protein 1 (MRP1) (AA 1-33), (N-Term) antibody
Immunofluorescence (IF) image for anti-Macrophage Inflammatory Protein Related Protein 1 (MRP1) (AA 1-33), (N-Term) antibody (ABIN189465) Immunocytochemistry/Immunofluorescence: MRP1 Antibody (IU5C1) [ABIN1894651] - Immunof...