anti-Human CRY1 Antikörper für Western Blotting

Recommended CRY1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Cryptochrome 1 (Photolyase-Like) (CRY1) Antikörper
  • cry1-A
  • CRY1
  • cry2
  • phll1
  • xCRY1
  • PHLL1
  • AU020726
  • AU021000
  • Phll1
  • ATCRY1
  • BLU1
  • BLUE LIGHT UNINHIBITED 1
  • CRYPTOCHROME 1 APOPROTEIN (BLUE LIGHT PHOTORECEPTOR
  • ELONGATED HYPOCOTYL 4
  • HY4
  • OOP2
  • OUT OF PHASE 2
  • T3H13.14
  • T3H13_14
  • cryptochrome 1
  • cryptochrome 1 (photolyase-like)
  • cryptochrome 1
  • LOC100384475
  • cryptochrome-1
  • cry1-A
  • CRY1
  • cry1
  • siu50817b
  • LOC100223409
  • LOC100347047
  • Cry1
Epitop
AA 153-189, N-Term
26
6
6
4
4
3
3
2
2
1
1
1
Reaktivität
Human, Ratte (Rattus)
65
19
9
4
3
2
2
2
2
2
1
1
1
1
Wirt
Kaninchen
50
21
3
Klonalität
Polyklonal
Konjugat
Dieser CRY1 Antikörper ist unkonjugiert
2
2
2
2
2
2
Applikation
Western Blotting (WB)
69
39
35
17
12
6
3
2
2
2
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN3042761
$ 240.00
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
3.1474795 ABIN390079 IHC (p) WB Rabbit Ig AA 556-586, C-Term Anmelden zum Anzeigen Polyclonal 4
3.1474795 ABIN2788200 IHC WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 1
3.1474795 ABIN781975 EIA IF IHC (p) WB Mouse IgG1 Anmelden zum Anzeigen 4H4-1C4
3.1474795 ABIN3197614 IHC WB Rabbit Anmelden zum Anzeigen Polyclonal
3.1474795 ABIN396476 WB Mouse IgG1 kappa AA 1-587 Anmelden zum Anzeigen 4H4-1C4
3.1474795 ABIN4892971 IHC IHC (p) SimWes WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal
3.1474795 ABIN2562023 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
3.1474795 ABIN560474 IF IHC (p) ELISA WB Mouse IgG1 kappa AA 1-586, full length Anmelden zum Anzeigen 4H4-1C4
3.1474795 ABIN514616 IF WB Mouse AA 1-586, full length Anmelden zum Anzeigen Polyclonal
1 ABIN358613 EIA IHC (p) WB Rabbit Ig C-Term Anmelden zum Anzeigen Polyclonal 5
1 ABIN958965 IHC (p) WB Rabbit AA 151-200 Anmelden zum Anzeigen Polyclonal
1 ABIN626034 IF IHC (p) ELISA WB Mouse IgG1, kappa AA 1-587 Anmelden zum Anzeigen 4H4-1C4
1 ABIN294034 IHC ELISA WB Goat IgG AA 115-224 Anmelden zum Anzeigen Polyclonal
1 ABIN201975 IHC ELISA WB Rabbit AA 571-586 Anmelden zum Anzeigen Polyclonal
1 ABIN603032 WB Mouse IgG1 C-Term Anmelden zum Anzeigen
1 ABIN1968827 IHC ELISA WB Biotin Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN1962327 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN1964706 IHC ELISA WB APC Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN1971131 IHC ELISA WB FITC Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2471173 IF IHC ELISA WB Mouse IgG1 kappa Anmelden zum Anzeigen 4H4-1C4

General

Antigen Cryptochrome 1 (Photolyase-Like) (CRY1) Antikörper
Epitop AA 153-189, N-Term
(26), (6), (6), (4), (4), (3), (3), (2), (2), (1), (1), (1)
Reaktivität Human, Ratte (Rattus)
(65), (19), (9), (4), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Wirt Kaninchen
(50), (21), (3)
Klonalität
Polyklonal
Konjugat Dieser CRY1 Antikörper ist unkonjugiert
(2), (2), (2), (2), (2), (2)
Applikation Western Blotting (WB)
(69), (39), (35), (17), (12), (6), (3), (2), (2), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-CRY1 Antikörper

Target Details CRY1 Anwendungsinformationen Handhabung Bilder
Verwendungszweck Rabbit IgG polyclonal antibody for Cryptochrome-1(CRY1) detection. Tested with WB in Human,Rat.
Sequenz FQTLISKMEP LEIPVETITS EVIEKCTTPL SDDHDEK
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Cryptochrome-1(CRY1) detection. Tested with WB in Human,Rat.
Gene Name: cryptochrome circadian clock 1
Protein Name: Cryptochrome-1
Reinigung Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human Cryptochrome I (153-189aa FQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids.
Isotyp IgG

Target Details CRY1

Produktdetails anti-CRY1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung CRY1 (CRY1 Antibody Abstract)
Hintergrund This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. And this gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of the related gene in mouse results in a shortened circadian cycle in complete darkness.

Synonyms: Cry1 antibody|CRY1_HUMAN antibody|Cryptochrome 1 (photolyase like) antibody|Cryptochrome 1 antibody|Cryptochrome-1 antibody|PHLL1 antibody|Photolyase 1 antibody|Photolyase-like antibody
Gen-ID 1407
UniProt Q16526
Pathways Response to Water Deprivation, Proton Transport

Anwendungsinformationen

Produktdetails anti-CRY1 Antikörper Target Details CRY1 Handhabung Bilder zurück nach oben
Applikationshinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.
Kommentare

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-CRY1 Antikörper Target Details CRY1 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeated freezing and thawing.
Lagerung 4 °C/-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Bilder

Produktdetails anti-CRY1 Antikörper Target Details CRY1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Cryptochrome 1 (Photolyase-Like) (CRY1) (AA 153-189), (N-Term) antibody (ABIN3042761) anti-Cryptochrome 1 (Photolyase-Like) (CRY1) (AA 153-189), (N-Term) antibody