anti-Human CRY1 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended CRY1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Cryptochrome 1 (Photolyase-Like) (CRY1) Antikörper
  • cry1-A
  • CRY1
  • cry2
  • phll1
  • xCRY1
  • PHLL1
  • AU020726
  • AU021000
  • Phll1
  • ATCRY1
  • BLU1
  • BLUE LIGHT UNINHIBITED 1
  • CRYPTOCHROME 1 APOPROTEIN (BLUE LIGHT PHOTORECEPTOR
  • ELONGATED HYPOCOTYL 4
  • HY4
  • OOP2
  • OUT OF PHASE 2
  • T3H13.14
  • T3H13_14
  • cryptochrome 1
  • cryptochrome 1 (photolyase-like)
  • cryptochrome 1
  • LOC100384475
  • cryptochrome-1
  • cry1-A
  • CRY1
  • cry1
  • siu50817b
  • LOC100223409
  • LOC100347047
  • Cry1
Epitop
N-Term
26
6
6
4
4
3
3
2
2
1
1
1
1
Reaktivität
Human
65
19
10
4
3
2
2
2
2
2
1
1
1
1
Wirt
Kaninchen
50
21
3
Klonalität
Polyklonal
Konjugat
Dieser CRY1 Antikörper ist unkonjugiert
2
2
2
2
2
2
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
69
39
34
17
11
6
3
2
2
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4892971
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN390079 IHC (p) WB Rabbit Ig AA 556-586, C-Term Anmelden zum Anzeigen Polyclonal 4
1 ABIN358613 EIA IHC (p) WB Rabbit Ig C-Term Anmelden zum Anzeigen Polyclonal 5
1 ABIN781975 EIA IF IHC (p) WB Mouse IgG1 Anmelden zum Anzeigen 4H4-1C4
1 ABIN958965 IHC (p) WB Rabbit AA 151-200 Anmelden zum Anzeigen Polyclonal
1 ABIN626034 IF IHC (p) ELISA WB Mouse IgG1, kappa AA 1-587 Anmelden zum Anzeigen 4H4-1C4
1 ABIN1723647 IF IHC (p) ELISA WB Mouse IgG1 kappa AA 1-587, full length Anmelden zum Anzeigen 4H4-1C4
1 ABIN560474 IF IHC (p) ELISA WB Mouse IgG1 kappa AA 1-586, full length Anmelden zum Anzeigen 4H4-1C4
1 ABIN224481 IF IHC (p) ELISA WB Mouse IgG1 AA 1-587 Anmelden zum Anzeigen
1 ABIN5534081 IHC (p) WB Rabbit Ig Fraction AA 556-586, C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN1804962 IHC (p) WB Rabbit AA 556-586 Anmelden zum Anzeigen Polyclonal
1 ABIN2769155 IHC (p) IHC ELISA WB Mouse IgG1, kappa Anmelden zum Anzeigen 4H4-1C4

General

Antigen Cryptochrome 1 (Photolyase-Like) (CRY1) Antikörper
Epitop N-Term
(26), (6), (6), (4), (4), (3), (3), (2), (2), (1), (1), (1), (1)
Reaktivität Human
(65), (19), (10), (4), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Wirt Kaninchen
(50), (21), (3)
Klonalität
Polyklonal
Konjugat Dieser CRY1 Antikörper ist unkonjugiert
(2), (2), (2), (2), (2), (2)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
(69), (39), (34), (17), (11), (6), (3), (2), (2), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-CRY1 Antikörper

Target Details CRY1 Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen Synthetic peptides corresponding to CRY1 (cryptochrome 1 (photolyase-like)) The peptide sequence was selected from the N terminal of CRY1 (NP_004066) Peptide sequence KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF.

Target Details CRY1

Produktdetails anti-CRY1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung CRY1 (CRY1 Antibody Abstract)
Hintergrund Gene Symbol: CRY1
Molekulargewicht Theoretical MW: 64 kDa
Gen-ID 1407
UniProt Q16526
Pathways Response to Water Deprivation, Proton Transport

Anwendungsinformationen

Produktdetails anti-CRY1 Antikörper Target Details CRY1 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100-1:2000, Simple Western 1:50, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 5 μg/mLIn Simple Western only 10 - 15 μL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-CRY1 Antikörper Target Details CRY1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-CRY1 Antikörper Target Details CRY1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Cryptochrome 1 (Photolyase-Like) (CRY1) (N-Term) antibody (ABIN4892971) Western Blot: CRY1 Antibody [NBP1-69080] - Sample Tissue: Hela Whole cell, Lane A: Pr...
Western Blotting (WB) image for anti-Cryptochrome 1 (Photolyase-Like) (CRY1) (N-Term) antibody (ABIN4892971) Western Blot: CRY1 Antibody [NBP1-69080] - Sample Tissue:Hela Whole cell. Lane A: Pri...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cryptochrome 1 (Photolyase-Like) (CRY1) (N-Term) antibody (ABIN4892971) Immunohistochemistry-Paraffin: CRY1 Antibody [NBP1-69080] - Human testis tissue at an...
Simple Western (SimWes) image for anti-Cryptochrome 1 (Photolyase-Like) (CRY1) (N-Term) antibody (ABIN4892971) Simple Western: CRY1 Antibody [NBP1-69080] - Simple Western lane view shows a specifi...