anti-Human NCK-Associated Protein 1-Like Antikörper für Immunohistochemistry

Recommended NCK-Associated Protein 1-Like Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
NCK-Associated Protein 1-Like (NCKAP1L) Antikörper
  • 4930568P13Rik
  • AI463083
  • Hem1
  • Hemp1
  • HEM1
  • NCK-associated protein 1-like
  • zgc:172352
  • NCK-associated protein 1
  • nck-associated protein 1-like
  • NCK associated protein 1 like
  • NCKAP1L
  • zgc:172352
  • NCKAP1
  • nckap1l
  • LOC100618382
  • LOC100639088
  • Nckap1l
Reaktivität
Human
57
36
28
11
8
8
6
4
3
3
2
1
1
Wirt
Kaninchen
39
19
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
24
24
13
8
2
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4316916
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4316915 IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2280327 IHC Goat Anmelden zum Anzeigen Polyclonal

General

Antigen NCK-Associated Protein 1-Like (NCKAP1L) Antikörper
Reaktivität Human
(57), (36), (28), (11), (8), (8), (6), (4), (3), (3), (2), (1), (1)
Wirt Kaninchen
(39), (19)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(24), (24), (13), (8), (2)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: FRAMAQEGLREVFSSHCPFLMGPIECLKEFVTPDTDIKVTLSIFELASAA GVGCDIDPALVAAIANLKADTSSPEE
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung HEM1 (NCKAP1L Antibody Abstract)
Hintergrund Gene Symbol: NCKAP1L
Gen-ID 3071
Pathways Regulation of Actin Filament Polymerization

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-NCK-Associated Protein 1-Like (NCKAP1L) antibody (ABIN4316916) Immunohistochemistry: HEM1 Antibody [NBP2-13644] - Staining of human hippocampus show...