anti-Human BAI1-Associated Protein 2-Like-1 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended BAI1-Associated Protein 2-Like-1 Antibody (geliefert von: Anmelden zum Anzeigen )

BAI1-Associated Protein 2-Like-1 (BAIAP2L1) Antikörper
  • cb1023
  • baiap2l1
  • zgc:85624
  • BAIAP2L1
  • MGC131079
  • 1300006M19Rik
  • AI585895
  • RGD1308452
  • BAI1-associated protein 2-like 1a
  • BAI1-associated protein 2-like 1
  • baiap2l1a
  • BAIAP2L1
  • baiap2l1
  • LOC100224219
  • Baiap2l1
Human, Ratte (Rattus)
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4282987
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
13.588177 ABIN4282988 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
13.588177 ABIN4282990 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
13.588177 ABIN4282989 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN614723 EIA IHC (p) WB Mouse IgG1 AA 398-512 Anmelden zum Anzeigen 2A4
1 ABIN2879266 IHC (p) ELISA WB Rabbit IgG AA 111-160 Anmelden zum Anzeigen Polyclonal
1 ABIN574455 IHC (p) ELISA WB Mouse IgG1, kappa AA 398-512 Anmelden zum Anzeigen 2A4
1 ABIN565967 IHC (p) ELISA WB Mouse IgG1 kappa AA 398-511, partial Anmelden zum Anzeigen 2A4
1 ABIN949489 IHC (p) ELISA WB Mouse IgG1 kappa AA 1-511, full length Anmelden zum Anzeigen 4A7
1 ABIN2962007 IHC (p) ELISA WB Rabbit IgG AA 111-160 Anmelden zum Anzeigen Polyclonal
1 ABIN1723591 IHC (p) ELISA WB Mouse IgG1 kappa AA 398-512 Anmelden zum Anzeigen 2A4
1 ABIN2589795 IHC (p) WB Rabbit Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN2768724 IHC (p) IHC ELISA WB Mouse IgG1, kappa Anmelden zum Anzeigen 2A4


Antigen BAI1-Associated Protein 2-Like-1 (BAIAP2L1) Antikörper
Reaktivität Human, Ratte (Rattus)
(39), (16), (16)
Wirt Kaninchen
(28), (11)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(37), (17), (12), (11), (8), (7), (1), (1), (1)
Hersteller Anmelden zum Anzeigen


Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EEKRRFCFLVDKHCGFANHIHYYHLQSAELLNSKLPRWQETCVDAIKVPEKIMNMIEEIKTPASTPVSGTPQASPMI
Isotyp IgG


Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung BAIAP2L1 (BAIAP2L1 Antibody Abstract)
Hintergrund Gene Symbol: BAIAP2L1
Gen-ID 55971
Forschungsgebiet Signaling, Microfilaments, Cytoskeleton
Pathways Regulation of Actin Filament Polymerization


Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-BAI1-Associated Protein 2-Like-1 (BAIAP2L1) antibody (ABIN4282987) Western Blot: BAIAP2L1 Antibody [NBP1-85940] - Lane 1: Marker [kDa] 230, 130, 95, 72,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-BAI1-Associated Protein 2-Like-1 (BAIAP2L1) antibody (ABIN4282987) Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-85940] - Staining of human sto...
Western Blotting (WB) image for anti-BAI1-Associated Protein 2-Like-1 (BAIAP2L1) antibody (ABIN4282987) Western Blot: BAIAP2L1 Antibody [NBP1-85940] - Lane 1: NIH-3T3 cell lysate (Mouse emb...