anti-Human KIF2B Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended KIF2B Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Kinesin Family Member 2B (KIF2B) Antikörper
  • 1700063D03Rik
  • kinesin family member 2B
  • KIF2B
  • Kif2b
Reaktivität
Human
31
20
20
4
4
4
2
2
1
1
1
Wirt
Kaninchen
31
Klonalität
Polyklonal
Konjugat
Dieser KIF2B Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
18
10
8
6
4
3
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4328838
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
13.400779 ABIN4328840 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN4328839 IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN903699 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN903687 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN873162 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5581888 IF IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5581887 IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN5581886 IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal

anti-KIF2B Antikörper für Immunohistochemistry (Paraffin-embedded Sections) mit den meisten Publikationen

Ähnliche anti-KIF2B Antikörper

Applikation / Reaktivität Human
ELISA 4 Antikörper
Immunochromatography (IC) 1 Antikörper
Immunocytochemistry (ICC) 2 Antikörper
Immunofluorescence (IF) 4 Antikörper
Immunofluorescence (fixed cells) (IF/ICC) 1 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 10 Antikörper
Immunohistochemistry (IHC) 7 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 9 Antikörper
Western Blotting (WB) 19 Antikörper

General

Antigen Kinesin Family Member 2B (KIF2B) Antikörper
Reaktivität Human
(31), (20), (20), (4), (4), (4), (2), (2), (1), (1), (1)
Wirt Kaninchen
(31)
Klonalität
Polyklonal
Konjugat Dieser KIF2B Antikörper ist unkonjugiert
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(18), (10), (8), (6), (4), (3), (1), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-KIF2B Antikörper

Target Details KIF2B Anwendungsinformationen Handhabung ProductDetails: References for anti-KIF2B antibody (ABIN4328838) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ALAPSSAIRDQRTATKWVAMIPQKNQTASGDSLDVRVPSKPCLMKQKKSPCLWEIQKLQEQREKRRRLQQEIRARRALDVNTRN
Isotyp IgG

Target Details KIF2B

Produktdetails anti-KIF2B Antikörper Anwendungsinformationen Handhabung ProductDetails: References for anti-KIF2B antibody (ABIN4328838) Bilder zurück nach oben
Antigen
Andere Bezeichnung KIF2B (KIF2B Antibody Abstract)
Hintergrund Gene Symbol: KIF2B
Gen-ID 84643
Forschungsgebiet Signaling, Cytoskeleton
Pathways Microtubule Dynamics

Anwendungsinformationen

Produktdetails anti-KIF2B Antikörper Target Details KIF2B Handhabung ProductDetails: References for anti-KIF2B antibody (ABIN4328838) Bilder zurück nach oben
Applikationshinweise Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 26656453).
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-KIF2B Antikörper Target Details KIF2B Anwendungsinformationen ProductDetails: References for anti-KIF2B antibody (ABIN4328838) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-KIF2B antibody (ABIN4328838)

Produktdetails anti-KIF2B Antikörper Target Details KIF2B Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Pillai, Nguyen, Johnson, Haura, Coppola, Chellappan: "Tank binding kinase 1 is a centrosome-associated kinase necessary for microtubule dynamics and mitosis." in: Nature communications, Vol. 6, pp. 10072, 2015 (Probematerial (Species): Human). Weitere Details: Immunocytochemistry,Immunofluorescence

Bilder

Produktdetails anti-KIF2B Antikörper Target Details KIF2B Anwendungsinformationen Handhabung ProductDetails: References for anti-KIF2B antibody (ABIN4328838) zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-KIF2B Antikörper (Kinesin Family Member 2B) (ABIN4328838) Western Blot: KIF2B Antibody [NBP1-86002] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-KIF2B Antikörper (Kinesin Family Member 2B) (ABIN4328838) Immunohistochemistry-Paraffin: KIF2B Antibody [NBP1-86002] - Immunohistochemical stai...