anti-Maus Optineurin Antikörper für Immunofluorescence

Recommended Optineurin Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Optineurin (OPTN) Antikörper
  • nrp
  • fip2
  • hip7
  • hypl
  • glc1e
  • tfiiia-intp
  • ALS12
  • FIP2
  • GLC1E
  • HIP7
  • HYPL
  • NRP
  • TFIIIA-INTP
  • Fip2
  • 4930441O07Rik
  • fj52f04
  • si:ch211-240l19.3
  • wu:fj52f04
  • zgc:66386
  • zgc:77868
  • optineurin
  • optineurin L homeolog
  • OPTN
  • optn
  • Optn
  • optn.L
Reaktivität
Human, Maus
90
41
23
10
7
7
6
5
5
3
2
2
2
1
1
Wirt
Kaninchen
89
4
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
72
25
23
20
13
12
7
5
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4341482
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1089740 IF IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1089741 IF IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2727923 EIA ICC IF IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Optineurin (OPTN) Antikörper
Reaktivität Human, Maus
(90), (41), (23), (10), (7), (7), (6), (5), (5), (3), (2), (2), (2), (1), (1)
Wirt Kaninchen
(89), (4)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(72), (25), (23), (20), (13), (12), (7), (5), (2), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Referenzen Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKG
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Referenzen Bilder zurück nach oben
Antigen
Andere Bezeichnung Optineurin (OPTN Antibody Abstract)
Hintergrund Gene Symbol: OPTN
Gen-ID 10133
Forschungsgebiet Neurology, Cytokines, Innate Immunity
Pathways M Phase

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Referenzen Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500, Immunohistochemistry-Frozen 1:10-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. Frozen sections done on mouse retina from customer review.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Referenzen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen

Produktdetails Antigendetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Smith, Sewell, Levine, Chew, Dunne, OShea, Smith, Harrison, Macdonald, Bloom, Segal: "Disruption of macrophage pro-inflammatory cytokine release in Crohn's disease is associated with reduced optineurin expression in a subset of patients." in: Immunology, Vol. 144, Issue 1, pp. 45-55, 2014 (Probematerial (Species): Human). Weitere Details: Western Blotting

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung Referenzen zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Optineurin (OPTN) antibody (ABIN4341482) Immunocytochemistry/Immunofluorescence: Optineurin Antibody [NBP1-84682] - Staining o...
Western Blotting (WB) image for anti-Optineurin (OPTN) antibody (ABIN4341482) Western Blot: Optineurin Antibody [NBP1-84682] - Lane 1: Marker [kDa] 220, 112, 84, 4...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Optineurin (OPTN) antibody (ABIN4341482) Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human o...
Immunohistochemistry (Frozen Sections) (IHC (fro)) image for anti-Optineurin (OPTN) antibody (ABIN4341482) Immunohistochemistry-Frozen: Optineurin Antibody [NBP1-84682] - Image and review of O...
Western Blotting (WB) image for anti-Optineurin (OPTN) antibody (ABIN4341482) Western Blot: Optineurin Antibody - Analysis in human cell line HDLM-2.
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Optineurin (OPTN) antibody (ABIN4341482) Immunohistochemistry-Paraffin: Optineurin Antibody - Staining of human pancreas show...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Optineurin (OPTN) antibody (ABIN4341482) Immunohistochemistry-Paraffin: Optineurin Antibody - Staining of human cerebral cort...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Optineurin (OPTN) antibody (ABIN4341482) Immunohistochemistry-Paraffin: Optineurin Antibody - Staining of human skin shows mo...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Optineurin (OPTN) antibody (ABIN4341482) Immunohistochemistry-Paraffin: Optineurin Antibody - Staining of human placenta show...