anti-Human Kallikrein 13 Antikörper für Immunohistochemistry

Recommended Kallikrein 13 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Kallikrein-Related Peptidase 13 (KLK13) Antikörper
  • Egfbp-2
  • mGk-13
  • KLK-L4
  • KLKL4
  • kallikrein related-peptidase 13
  • kallikrein-13-like
  • kallikrein-related peptidase 13
  • Klk13
  • LOC540297
  • KLK13
Reaktivität
Human
73
21
20
4
3
3
3
1
Wirt
Kaninchen
49
22
4
Klonalität
Polyklonal
Konjugat
Dieser Kallikrein 13 Antikörper ist unkonjugiert
4
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Western Blotting (WB)
54
20
13
10
8
4
4
2
2
1
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4328017
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
9.452184 ABIN2430369 IHC ELISA Rabbit IgG Anmelden zum Anzeigen Polyclonal
9.452184 ABIN2423717 IHC ELISA Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN152282 IHC (fro) IHC (p) IHC ELISA WB Rabbit AA 262-277 Anmelden zum Anzeigen Polyclonal
1 ABIN1868857 ICC IHC IP WB Rabbit IgG AA 22-277 Anmelden zum Anzeigen Polyclonal
1 ABIN2467310 IHC ELISA WB Rabbit IgG AA 262-277 Anmelden zum Anzeigen Polyclonal
1 ABIN2294907 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2768652 IHC (p) IHC ELISA WB Rabbit IgG AA 262-277 Anmelden zum Anzeigen Polyclonal
1 ABIN2936137 ELISA IF/ICC IHC WB Rabbit AA 22-277 Anmelden zum Anzeigen Polyclonal

General

Antigen Kallikrein-Related Peptidase 13 (KLK13) Antikörper
Reaktivität Human
(73), (21), (20), (4), (3), (3), (3), (1)
Wirt Kaninchen
(49), (22), (4)
Klonalität
Polyklonal
Konjugat Dieser Kallikrein 13 Antikörper ist unkonjugiert
(4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Western Blotting (WB)
(54), (20), (13), (10), (8), (4), (4), (2), (2), (1), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-Kallikrein 13 Antikörper

Target Details Kallikrein 13 Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids:LKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLNHDHDIMLLELQSPVQLTGYIQTLPLSHNNRLTPGTT
Isotyp IgG

Target Details Kallikrein 13

Produktdetails anti-Kallikrein 13 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Kallikrein 13 (KLK13 Antibody Abstract)
Hintergrund Gene Symbol: KLK13
Gen-ID 26085
Pathways Komplementsystem

Anwendungsinformationen

Produktdetails anti-Kallikrein 13 Antikörper Target Details Kallikrein 13 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry 1:500 - 1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-Kallikrein 13 Antikörper Target Details Kallikrein 13 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-Kallikrein 13 Antikörper Target Details Kallikrein 13 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Kallikrein-Related Peptidase 13 (KLK13) antibody (ABIN4328017) Immunohistochemistry: Kallikrein 13 Antibody [NBP2-49358] - Staining of human esophag...
Western Blotting (WB) image for anti-Kallikrein-Related Peptidase 13 (KLK13) antibody (ABIN4328017) Western Blot: Kallikrein 13 Antibody [NBP2-49358] - Lane 1: Marker [kDa] 250, 130, 95...