anti-Human Kallikrein 13 Antikörper für Immunohistochemistry

Recommended Kallikrein 13 Antibody (geliefert von: Anmelden zum Anzeigen )

Kallikrein-Related Peptidase 13 (KLK13) Antikörper
  • Egfbp-2
  • mGk-13
  • KLK-L4
  • KLKL4
  • kallikrein related-peptidase 13
  • kallikrein-13-like
  • kallikrein-related peptidase 13
  • Klk13
  • LOC540297
  • KLK13
Dieser Kallikrein 13 Antikörper ist unkonjugiert
Immunohistochemistry (IHC), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4328017
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
9.637035 ABIN2430369 IHC ELISA Rabbit IgG Anmelden zum Anzeigen Polyclonal
9.637035 ABIN2423717 IHC ELISA Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN152282 IHC (fro) IHC (p) IHC ELISA WB Rabbit AA 262-277 Anmelden zum Anzeigen Polyclonal
1 ABIN2467310 IHC ELISA WB Rabbit IgG AA 262-277 Anmelden zum Anzeigen Polyclonal
1 ABIN1868857 ICC IHC IP WB Rabbit IgG AA 22-277 Anmelden zum Anzeigen Polyclonal
1 ABIN2294907 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2768652 IHC (p) IHC ELISA WB Rabbit IgG AA 262-277 Anmelden zum Anzeigen Polyclonal
1 ABIN2936137 ELISA IF/ICC IHC WB Rabbit AA 22-277 Anmelden zum Anzeigen Polyclonal

Ähnliche anti-Kallikrein 13 Antikörper

Applikation / Reaktivität Human
Blocking Peptide (BP) 1 Antikörper
Cell Culture (CC) 1 Antikörper
ELISA 19 Antikörper
Enzyme Immunoassay (EIA) 1 Antikörper
Immunocytochemistry (ICC) 1 Antikörper
Immunofluorescence (fixed cells) (IF/ICC) 1 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antikörper
Immunohistochemistry (IHC) 9 Antikörper
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 8 Antikörper
Immunoprecipitation (IP) 3 Antikörper
Neutralization (Neut) 4 Antikörper
Western Blotting (WB) 53 Antikörper


Antigen Kallikrein-Related Peptidase 13 (KLK13) Antikörper
Reaktivität Human
(73), (21), (20), (4), (3), (3), (3), (1)
Wirt Kaninchen
(49), (22), (4)
Konjugat Dieser Kallikrein 13 Antikörper ist unkonjugiert
(4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Western Blotting (WB)
(54), (20), (13), (10), (8), (4), (4), (2), (2), (1), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-Kallikrein 13 Antikörper

Target Details Kallikrein 13 Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids:LKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLNHDHDIMLLELQSPVQLTGYIQTLPLSHNNRLTPGTT
Isotyp IgG

Target Details Kallikrein 13

Produktdetails anti-Kallikrein 13 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung Kallikrein 13 (KLK13 Antibody Abstract)
Hintergrund Gene Symbol: KLK13
Gen-ID 26085
Pathways Komplementsystem


Produktdetails anti-Kallikrein 13 Antikörper Target Details Kallikrein 13 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry 1:500 - 1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-Kallikrein 13 Antikörper Target Details Kallikrein 13 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-Kallikrein 13 Antikörper Target Details Kallikrein 13 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Kallikrein 13 Antikörper (Kallikrein-Related Peptidase 13) (ABIN4328017) Immunohistochemistry: Kallikrein 13 Antibody [NBP2-49358] - Staining of human esophag...
Western Blotting (WB) image for anti-Kallikrein 13 Antikörper (Kallikrein-Related Peptidase 13) (ABIN4328017) Western Blot: Kallikrein 13 Antibody [NBP2-49358] - Lane 1: Marker [kDa] 250, 130, 95...