anti-Ratte (Rattus) PTPN11 Antikörper für Western Blotting

Recommended PTPN11 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Protein tyrosine Phosphatase, Non-Receptor Type 11 (PTPN11) Antikörper
  • BPTP3
  • CFC
  • NS1
  • PTP-1D
  • PTP2C
  • SH-PTP2
  • SH-PTP3
  • SHP2
  • 2700084A17Rik
  • AW536184
  • PTP1D
  • SAP-2
  • SHP-2
  • Shp2
  • Syp
  • SYP
  • protein tyrosine phosphatase, non-receptor type 11
  • PTPN11
  • Ptpn11
Epitop
AA 69-99, N-Term
54
47
25
21
19
16
15
15
15
10
5
4
3
3
3
3
3
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
367
230
201
14
13
13
11
11
10
9
7
4
3
3
2
2
2
1
Wirt
Kaninchen
297
58
19
2
1
Klonalität
Polyklonal
Konjugat
Dieser PTPN11 Antikörper ist unkonjugiert
9
9
9
6
6
5
4
4
4
4
4
4
4
4
4
4
4
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
290
126
106
84
52
49
33
22
18
6
3
3
3
2
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN3043912
340,48 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
3.3487515 ABIN968068 IF IP IHC WB Mouse IgG1 AA 1-177 Anmelden zum Anzeigen 79-PTP1D-SHP2 5
3.3487515 ABIN968069 IF IP IHC WB Mouse IgG1 AA 1-177 Anmelden zum Anzeigen 79-PTP1D-SHP2 5
3.3487515 ABIN2476469 WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 2
3.3487515 ABIN2774149 IHC WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal
3.3487515 ABIN3044088 WB Rabbit IgG AA 582-597, C-Term Anmelden zum Anzeigen Polyclonal
3.3487515 ABIN3044337 IHC (p) WB Rabbit IgG AA 578-592, C-Term Anmelden zum Anzeigen Polyclonal
3.3487515 ABIN745838 IF (p) IHC (p) WB Rabbit IgG AA 550-597, pTyr584 Anmelden zum Anzeigen Polyclonal
3.3487515 ABIN1531196 IHC ELISA WB Rabbit IgG pTyr542 Anmelden zum Anzeigen Polyclonal
3.3487515 ABIN1531197 IHC ELISA WB Rabbit IgG pTyr580 Anmelden zum Anzeigen Polyclonal
3.3487515 ABIN673749 IF (p) IHC (p) WB Rabbit IgG AA 515-560 Anmelden zum Anzeigen Polyclonal
3.3487515 ABIN712541 IF (p) IHC (p) WB Rabbit IgG pTyr81 Anmelden zum Anzeigen Polyclonal
3.3487515 ABIN1108792 IHC (p) WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal
3.3487515 ABIN1533396 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
3.3487515 ABIN1532213 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
3.3487515 ABIN1532212 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
3.3487515 ABIN3182470 ELISA IHC WB Rabbit IgG pTyr580 Anmelden zum Anzeigen Polyclonal
3.3487515 ABIN3182469 ELISA IHC WB Rabbit IgG pTyr542 Anmelden zum Anzeigen Polyclonal
3.3487515 ABIN3186954 ELISA IHC WB Rabbit IgG Thr497 Anmelden zum Anzeigen Polyclonal
3.3487515 ABIN3186953 ELISA IHC WB Rabbit IgG Thr494 Anmelden zum Anzeigen Polyclonal
3.3487515 ABIN3186955 ELISA IHC WB Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal

anti-PTPN11 Antikörper für Western Blotting mit den meisten Publikationen

Ähnliche anti-PTPN11 Antikörper

Applikation / Reaktivität Human Maus Ratte (Rattus)
Immunofluorescence (fixed cells) (IF/ICC) 3 Antikörper 1 Antikörper 1 Antikörper
Cytometry by Time of Flight (CyTOF) 1 Antikörper
Western Blotting (WB) 282 Antikörper 161 Antikörper 139 Antikörper
Proximity Ligation Assay (PLA) 1 Antikörper
Neutralization (Neut) 1 Antikörper 1 Antikörper 1 Antikörper
Intracellular Staining (ICS) 2 Antikörper 2 Antikörper 1 Antikörper
Immunoprecipitation (IP) 12 Antikörper 17 Antikörper 10 Antikörper

General

Antigen Protein tyrosine Phosphatase, Non-Receptor Type 11 (PTPN11) Antikörper
Epitop AA 69-99, N-Term
(54), (47), (25), (21), (19), (16), (15), (15), (15), (10), (5), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reaktivität Human, Maus, Ratte (Rattus)
(367), (230), (201), (14), (13), (13), (11), (11), (10), (9), (7), (4), (3), (3), (2), (2), (2), (1)
Wirt Kaninchen
(297), (58), (19), (2), (1)
Klonalität
Polyklonal
Konjugat Dieser PTPN11 Antikörper ist unkonjugiert
(9), (9), (9), (6), (6), (5), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(290), (126), (106), (84), (52), (49), (33), (22), (18), (6), (3), (3), (3), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-PTPN11 Antikörper

Target Details PTPN11 Anwendungsinformationen Handhabung Bilder
Verwendungszweck Rabbit IgG polyclonal antibody for Tyrosine-protein phosphatase non-receptor type 11(PTPN11) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Sequenz EKFATLAELV QYYMEHHGQL KEKNGDVIEL K
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Tyrosine-protein phosphatase non-receptor type 11(PTPN11) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: protein tyrosine phosphatase, non-receptor type 11
Protein Name: Tyrosine-protein phosphatase non-receptor type 11
Reinigung Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK), identical to the related mouse and rat sequences.
Isotyp IgG

Target Details PTPN11

Produktdetails anti-PTPN11 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung PTPN11 (PTPN11 Antibody Abstract)
Hintergrund PTPN11 (Tyrosine-protein phosphatase non-receptor type 11), also known as protein-tyrosine phosphatase 1D (PTP-1D), protein-tyrosine phosphatase 2C (PTP-2C), TYROSINE PHOSPHATASE SHP2 (SHP2), BPTP3, SH-PTP2, SHP-2, SH-PTP3, is an enzyme that in humans is encoded by the PTPN11 gene. PTPN11 is a member of the protein tyrosine phosphatase (PTP) family. The open reading frame consists of 1,779 nucleotides potentially encoding a protein of 593 amino acids with a predicted molecular mass of 68 kD. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.

Synonyms: BPTP 3 antibody|BPTP3 antibody|CFC antibody|MGC14433 antibody|Noonan syndrome 1 antibody|Noonan syndrome 1 protein tyrosine phosphatase 2C antibody|NS 1 antibody|NS1 antibody|OTTHUMP00000166107 antibody|OTTHUMP00000166108 antibody|Protein tyrosine phosphatase 2 antibody|Protein tyrosine phosphatase 2C antibody|Protein Tyrosine Phosphatase Non receptor Type 11 antibody|Protein-tyrosine phosphatase 1D antibody|Protein-tyrosine phosphatase 2C antibody|PTN11_HUMAN antibody|PTP 1D antibody|PTP 2C antibody|PTP-1D antibody|PTP-2C antibody|PTP1D antibody|PTP2C antibody|PTPN 11 antibody|PTPN11 antibody|PTPN11 antibody|SAP2 antibody|SH PTP2 antibody|SH PTP3 antibody|SH-PTP2 antibody|SH-PTP3 antibody|SH2 domain containing protein tyrosine phosphatase 2 antibody|SHIP2 antibody|SHP 2 antibody|SHP-2 antibody|Shp2 antibody|SHPTP 2 antibody|SHPTP2 antibody|SHPTP3 antibody|SIT protein precursor antibody| Syp antibody|Tyrosine protein phosphatase non receptor type 11 antibody|Tyrosine-protein phosphatase non-receptor type 11 antibody
Gen-ID 5781
UniProt Q06124
Pathways JAK-STAT Signalweg, RTK Signalweg, T-Zell Rezeptor Signalweg, Interferon-gamma Pathway, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, Toll-Like Receptors Cascades, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals

Anwendungsinformationen

Produktdetails anti-PTPN11 Antikörper Target Details PTPN11 Handhabung Bilder zurück nach oben
Applikationshinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Kommentare

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-PTPN11 Antikörper Target Details PTPN11 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeated freezing and thawing.
Lagerung 4 °C/-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Bilder

Produktdetails anti-PTPN11 Antikörper Target Details PTPN11 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-PTPN11 Antikörper (Protein tyrosine Phosphatase, Non-Receptor Type 11) (AA 69-99) (ABIN3043912) anti-Protein tyrosine Phosphatase, Non-Receptor Type 11 (PTPN11) (AA 69-99), (N-Term) antibody
Immunohistochemistry (IHC) image for anti-PTPN11 Antikörper (Protein tyrosine Phosphatase, Non-Receptor Type 11) (AA 69-99) (ABIN3043912) Anti- SHP2 Picoband antibody,IHC(P) IHC(P): Human Lung Cancer Tissue
Immunohistochemistry (IHC) image for anti-PTPN11 Antikörper (Protein tyrosine Phosphatase, Non-Receptor Type 11) (AA 69-99) (ABIN3043912) Anti- SHP2 Picoband antibody,IHC(P) IHC(P): Rat Skeletal Muscle Tissue
Immunohistochemistry (IHC) image for anti-PTPN11 Antikörper (Protein tyrosine Phosphatase, Non-Receptor Type 11) (AA 69-99) (ABIN3043912) Anti- SHP2 Picoband antibody,IHC(P) IHC(P): Mouse Cardiac Muscle Tissue