anti-Human ZC3H12A Antikörper für Immunohistochemistry

Recommended ZC3H12A Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Zinc Finger CCCH-Type Containing 12A (ZC3H12A) Antikörper
  • BC036563
  • MCPIP
  • Mcpip1
  • RGD1306776
  • MCPIP1
  • RP3-423B22.1
  • dJ423B22.1
  • zinc finger CCCH-type containing 12A
  • zinc finger CCCH type containing 12A
  • ZC3H12A
  • Zc3h12a
Reaktivität
Human
32
5
3
2
1
1
Wirt
Kaninchen
31
1
Klonalität
Polyklonal
Konjugat
Dieser ZC3H12A Antikörper ist unkonjugiert
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
30
19
13
9
6
6
4
2
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4333223
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
9.123373 ABIN2430425 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
9.123373 ABIN2423769 IHC ELISA Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2856778 ICC IF IP IHC WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal
1 ABIN4333225 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1949520 FACS IHC ELISA WB APC Rabbit IgG AA 331-358 Anmelden zum Anzeigen Polyclonal
1 ABIN1949522 FACS IHC ELISA WB FITC Rabbit IgG AA 331-358 Anmelden zum Anzeigen Polyclonal
1 ABIN1949518 FACS IHC ELISA WB HRP Rabbit IgG AA 331-358 Anmelden zum Anzeigen Polyclonal
1 ABIN1949519 FACS IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 331-358 Anmelden zum Anzeigen Polyclonal
1 ABIN1949523 FACS IHC ELISA WB PE Rabbit IgG AA 331-358 Anmelden zum Anzeigen Polyclonal
1 ABIN1949521 FACS IHC ELISA WB Biotin Rabbit IgG AA 331-358 Anmelden zum Anzeigen Polyclonal
1 ABIN2569125 ELISA FACS IHC WB Rabbit IgG AA 331-358 Anmelden zum Anzeigen Polyclonal
1 ABIN1886326 IF IHC WB Rabbit AA 291-474 Anmelden zum Anzeigen Polyclonal
1 ABIN2800421 IF (cc) IF IHC WB Rabbit IgG AA 241-504 Anmelden zum Anzeigen Polyclonal

General

Antigen Zinc Finger CCCH-Type Containing 12A (ZC3H12A) Antikörper
Reaktivität Human
(32), (5), (3), (2), (1), (1)
Wirt Kaninchen
(31), (1)
Klonalität
Polyklonal
Konjugat Dieser ZC3H12A Antikörper ist unkonjugiert
(1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(30), (19), (13), (9), (6), (6), (4), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-ZC3H12A Antikörper

Target Details ZC3H12A Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: CTYGIKCRFFHPERPSCPQRSVADELRANALLSPPRAPSKDKNGRRPSPSSQSSSLLTESEQCSLDGKKLGAQASPGSRQEGLTQTYAPSGRSLAP

Target Details ZC3H12A

Produktdetails anti-ZC3H12A Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung MCPIP1/ZC3H12A (ZC3H12A Antibody Abstract)
Hintergrund Gene Symbol: ZC3H12A
Gen-ID 80149
UniProt Q5D1E8
Pathways Cellular Response to Molecule of Bacterial Origin, Positive Regulation of fat Cell Differentiation

Anwendungsinformationen

Produktdetails anti-ZC3H12A Antikörper Target Details ZC3H12A Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-ZC3H12A Antikörper Target Details ZC3H12A Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-ZC3H12A Antikörper Target Details ZC3H12A Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Zinc Finger CCCH-Type Containing 12A (ZC3H12A) antibody (ABIN4333223) Immunohistochemistry: MCPIP1/ZC3H12A Antibody [NBP2-37871] - Staining of human append...
Immunofluorescence (IF) image for anti-Zinc Finger CCCH-Type Containing 12A (ZC3H12A) antibody (ABIN4333223) Immunocytochemistry/Immunofluorescence: MCPIP1/ZC3H12A Antibody - Staining of human ...