anti-Human GBP6 Antikörper für Immunohistochemistry

Recommended GBP6 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Guanylate Binding Protein 6 (GBP6) Antikörper
  • AI595338
  • Mpa2l
  • guanylate binding protein 6
  • guanylate binding protein family, member 6
  • Gbp6
  • GBP6
Reaktivität
Human
14
6
2
2
2
2
2
2
1
1
Wirt
Kaninchen
14
Klonalität
Polyklonal
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
14
7
4
3
3
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4313708
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN2686502 IHC ELISA WB Rabbit AA 472-622 Anmelden zum Anzeigen Polyclonal
1 ABIN2417615 IF IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1856394 IHC ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal

General

Antigen Guanylate Binding Protein 6 (GBP6) Antikörper
Reaktivität Human
(14), (6), (2), (2), (2), (2), (2), (2), (1), (1)
Wirt Kaninchen
(14)
Klonalität
Polyklonal
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(14), (7), (4), (3), (3), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-GBP6 Antikörper

Target Details GBP6 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EREHLLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNLADELTAILSAPAKLIGHGVKGV
Isotyp IgG

Target Details GBP6

Produktdetails anti-GBP6 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung GBP6 (GBP6 Antibody Abstract)
Hintergrund Gene Symbol: GBP6
Gen-ID 163351
Pathways Cellular Response to Molecule of Bacterial Origin

Anwendungsinformationen

Produktdetails anti-GBP6 Antikörper Target Details GBP6 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-GBP6 Antikörper Target Details GBP6 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-GBP6 Antikörper Target Details GBP6 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Guanylate Binding Protein 6 (GBP6) antibody (ABIN4313708) Western Blot: GBP6 Antibody [NBP1-84117] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Guanylate Binding Protein 6 (GBP6) antibody (ABIN4313708) Immunohistochemistry-Paraffin: GBP6 Antibody [NBP1-84117] - Staining of human esophag...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Guanylate Binding Protein 6 (GBP6) antibody (ABIN4313708) Immunohistochemistry-Paraffin: GBP6 Antibody [NBP1-84117] - Staining of human testis ...