anti-Human Bystin-Like Antikörper für Immunocytochemistry

Recommended Bystin-Like Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Bystin-Like (BYSL) Antikörper
  • CG1430
  • Dmel\\CG1430
  • MGC63889
  • zgc:63889
  • MGC81422
  • MGC97811
  • BYSTIN
  • Bys
  • Enp1
  • by S6
  • bystin-like
  • bystin
  • Bystin
  • bys
  • bysl
  • BYSL
  • LmjF30.0480
  • MCYG_02768
  • BYS1
  • LOC100159994
  • byst
  • LOC100270780
  • Bysl
Reaktivität
Human
10
2
Wirt
Kaninchen
6
4
Klonalität
Polyklonal
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
10
7
2
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4285612
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4285613 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Bystin-Like (BYSL) Antikörper
Reaktivität Human
(10), (2)
Wirt Kaninchen
(6), (4)
Klonalität
Polyklonal
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(10), (7), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QQQEELEAEHGTGDKPAAPRERTTRLGPRMPQDGSDDEDEEWPTLEKAATMTAAGHHAEVVVDPEDERAIEMFMNKNPPAR
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung BYSL (BYSL Antibody Abstract)
Hintergrund Gene Symbol: BYSL
Gen-ID 705
Forschungsgebiet DNA/RNA, Chromatin and Nuclear Signaling
Pathways Cellular Response to Molecule of Bacterial Origin

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Bystin-Like (BYSL) antibody (ABIN4285612) Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89500] - Staining of human esophag...
Western Blotting (WB) image for anti-Bystin-Like (BYSL) antibody (ABIN4285612) Western Blot: BYSL Antibody [NBP1-89500] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunofluorescence (IF) image for anti-Bystin-Like (BYSL) antibody (ABIN4285612) Immunocytochemistry/Immunofluorescence: BYSL Antibody [NBP1-89500] - Staining of huma...