SLC13A2 Antikörper

Produktnummer ABIN635937

Produktdetails anti-SLC13A2 Antikörper

Target: SLC13A2 (Solute Carrier Family 13 Member 2 (SLC13A2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC13A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC13 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC13A2 Blocking Peptide, catalog no. 33R-7231, is also available for use as a blocking control in assays to test for specificity of this SLC13A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC13A2

Target: SLC13A2 (Solute Carrier Family 13 Member 2 (SLC13A2))

Andere Bezeichnung: SLC13A2 (SLC13A2 Produkte)

Synonyme: NADC1 antikoerper, NaCT antikoerper, NaDC-1 antikoerper, SDCT1 antikoerper, Nadc1 antikoerper, mucin antikoerper, mNaDC-1 antikoerper, INDY antikoerper, nact antikoerper, slc13a2 antikoerper, slc13a5 antikoerper, wu:fd51b01 antikoerper, wu:fi13d08 antikoerper, wu:fi31b05 antikoerper, zgc:55601 antikoerper, zgc:77607 antikoerper, solute carrier family 13 member 2 antikoerper, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2 antikoerper, solute carrier family 13 member 5 L homeolog antikoerper, SLC13A2 antikoerper, Slc13a2 antikoerper, slc13a5.L antikoerper, slc13a2 antikoerper

Hintergrund: SLC13A2 belongs to the SLC13A transporter family, NADC subfamily. It is a multi-pass membrane protein. SLC13A2 cotransports of sodium ions and dicarboxylates such as succinate and citrate.

Molekulargewicht: 64 kDa (MW of target protein)