B3GALTL Antikörper (Middle Region)

Produktnummer ABIN635816

Produktdetails anti-B3GALTL Antikörper

Target: B3GALTL (beta 1,3-Galactosyltransferase-Like (B3GALTL))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser B3GALTL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: B3 GALTL antibody was raised against the middle region of B3 ALTL

Aufreinigung: Affinity purified

Immunogen: B3 GALTL antibody was raised using the middle region of B3 ALTL corresponding to a region with amino acids DYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

B3GALTL Blocking Peptide, catalog no. 33R-2243, is also available for use as a blocking control in assays to test for specificity of this B3GALTL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALTL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu B3GALTL

Target: B3GALTL (beta 1,3-Galactosyltransferase-Like (B3GALTL))

Andere Bezeichnung: B3GALTL (B3GALTL Produkte)

Synonyme: B3GLCT antikoerper, B3GTL antikoerper, B3Glc-T antikoerper, Gal-T antikoerper, beta3Glc-T antikoerper, Gm1057 antikoerper, beta 3-glucosyltransferase antikoerper, beta 3-glucosyltransferase L homeolog antikoerper, beta-3-glucosyltransferase antikoerper, B3GLCT antikoerper, b3glct antikoerper, b3glct.L antikoerper, B3glct antikoerper

Hintergrund: B3GALTL is the O-fucosyltransferase that transfers glucose toward fucose with a beta-1,3 linkage. B3GALTL specifically glucosylates O-linked fucosylglycan on TSP type-1 domains of proteins, thereby contributing to elongation of O-fucosylglycan.B3GALTL is a beta-1,3-glucosyltransferase involved in the synthesis of the unusual O-linked disaccharide glucosyl-beta-1,3-fucose-O- found on the thrombospondin type-1 repeats (TSRs) of many biologically important proteins.

Molekulargewicht: 56 kDa (MW of target protein)