MAN1A2 Antikörper (Middle Region)
-
- Target Alle MAN1A2 Antikörper anzeigen
- MAN1A2 (Mannosidase, Alpha, Class 1A, Member 2 (MAN1A2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MAN1A2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MAN1 A2 antibody was raised against the middle region of MAN1 2
- Aufreinigung
- Affinity purified
- Immunogen
- MAN1 A2 antibody was raised using the middle region of MAN1 2 corresponding to a region with amino acids FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE
- Top Product
- Discover our top product MAN1A2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MAN1A2 Blocking Peptide, catalog no. 33R-2844, is also available for use as a blocking control in assays to test for specificity of this MAN1A2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAN0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAN1A2 (Mannosidase, Alpha, Class 1A, Member 2 (MAN1A2))
- Andere Bezeichnung
- MAN1A2 (MAN1A2 Produkte)
- Synonyme
- man1b antikoerper, MAN1B antikoerper, AI428775 antikoerper, AI528764 antikoerper, AI854422 antikoerper, Man1b antikoerper, PCR2 antikoerper, mannosidase, alpha, class 1A, member 2 L homeolog antikoerper, mannosidase alpha class 1A member 2 antikoerper, mannosidase, alpha, class 1A, member 2 antikoerper, man1a2.L antikoerper, MAN1A2 antikoerper, Man1a2 antikoerper
- Hintergrund
- Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cells.
- Molekulargewicht
- 73 kDa (MW of target protein)
-