SLC12A8 Antikörper
-
- Target Alle SLC12A8 (Slc12a8) Antikörper anzeigen
- SLC12A8 (Slc12a8) (Solute Carrier Family 12 (Potassium/chloride Transporters), Member 8 (Slc12a8))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC12A8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC12 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIRLQLLLLFLLAVSTLDFVVGSFTHLDPEHGFIGYSPELLQNNTLPDYS
- Top Product
- Discover our top product Slc12a8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC12A8 Blocking Peptide, catalog no. 33R-4006, is also available for use as a blocking control in assays to test for specificity of this SLC12A8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC12A8 (Slc12a8) (Solute Carrier Family 12 (Potassium/chloride Transporters), Member 8 (Slc12a8))
- Andere Bezeichnung
- SLC12A8 (Slc12a8 Produkte)
- Synonyme
- CCC9 antikoerper, E330020C02Rik antikoerper, Ccc9 antikoerper, solute carrier family 12 member 8 antikoerper, zinc finger protein 148 antikoerper, solute carrier family 12 (potassium/chloride transporters), member 8 antikoerper, solute carrier family 12, member 8 antikoerper, solute carrier family 12, member 8 L homeolog antikoerper, SLC12A8 antikoerper, ZNF148 antikoerper, Slc12a8 antikoerper, slc12a8.L antikoerper
- Hintergrund
- SLC12A8 is a cation/chloride cotransporter that may play a role in the control of keratinocyte proliferation.
- Molekulargewicht
- 78 kDa (MW of target protein)
-