MUC15 Antikörper (Middle Region)
-
- Target Alle MUC15 Antikörper anzeigen
- MUC15 (Mucin 15, Cell Surface Associated (MUC15))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MUC15 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MUC15 antibody was raised against the middle region of MUC15
- Aufreinigung
- Affinity purified
- Immunogen
- MUC15 antibody was raised using the middle region of MUC15 corresponding to a region with amino acids KFTNNSKLFPNTSDPQKENRNTGIVFGAILGAILGVSLLTLVGYLLCGKR
- Top Product
- Discover our top product MUC15 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MUC15 Blocking Peptide, catalog no. 33R-4381, is also available for use as a blocking control in assays to test for specificity of this MUC15 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC15 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MUC15 (Mucin 15, Cell Surface Associated (MUC15))
- Andere Bezeichnung
- MUC15 (MUC15 Produkte)
- Synonyme
- 4732460E09 antikoerper, D730046L02Rik antikoerper, MUC-15 antikoerper, PAS3 antikoerper, PASIII antikoerper, mucin 15, cell surface associated antikoerper, mucin 15 antikoerper, MUC15 antikoerper, Muc15 antikoerper
- Hintergrund
- MUC15 may play a role in the cell adhesion to the extracellular matrix.
- Molekulargewicht
- 36 kDa (MW of target protein)
-