MMEL1 Antikörper (Middle Region)
-
- Target Alle MMEL1 Antikörper anzeigen
- MMEL1 (Membrane Metallo-Endopeptidase-Like 1 (MMEL1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MMEL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MMEL1 antibody was raised against the middle region of MMEL1
- Aufreinigung
- Affinity purified
- Immunogen
- MMEL1 antibody was raised using the middle region of MMEL1 corresponding to a region with amino acids EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV
- Top Product
- Discover our top product MMEL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MMEL1 Blocking Peptide, catalog no. 33R-2809, is also available for use as a blocking control in assays to test for specificity of this MMEL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMEL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MMEL1 (Membrane Metallo-Endopeptidase-Like 1 (MMEL1))
- Andere Bezeichnung
- MMEL1 (MMEL1 Produkte)
- Synonyme
- MMEL2 antikoerper, NEP2 antikoerper, NEPII antikoerper, NL1 antikoerper, NL2 antikoerper, SEP antikoerper, Mell1 antikoerper, Nl1 antikoerper, MMEL1 antikoerper, membrane metalloendopeptidase like 1 antikoerper, membrane metallo-endopeptidase-like 1 antikoerper, MMEL1 antikoerper, Mmel1 antikoerper, mmel1 antikoerper
- Hintergrund
- MMEL1 is a member of the neutral endopeptidase (NEP) or membrane metallo-endopeptidase (MME) family. Family members play important roles in pain perception, arterial pressure regulation, phosphate metabolism and homeostasis.
- Molekulargewicht
- 88 kDa (MW of target protein)
-