ROM1 Antikörper (Middle Region)
-
- Target Alle ROM1 Antikörper anzeigen
- ROM1 (Retinal Outer Segment Membrane Protein 1 (ROM1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ROM1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ROM1 antibody was raised against the middle region of ROM1
- Aufreinigung
- Affinity purified
- Immunogen
- ROM1 antibody was raised using the middle region of ROM1 corresponding to a region with amino acids NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGT
- Top Product
- Discover our top product ROM1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ROM1 Blocking Peptide, catalog no. 33R-6819, is also available for use as a blocking control in assays to test for specificity of this ROM1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ROM1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ROM1 (Retinal Outer Segment Membrane Protein 1 (ROM1))
- Andere Bezeichnung
- ROM1 (ROM1 Produkte)
- Synonyme
- ROM antikoerper, ROSP1 antikoerper, RP7 antikoerper, TSPAN23 antikoerper, ROM1 antikoerper, M101156 antikoerper, Rgsc1156 antikoerper, Rom-1 antikoerper, Rosp1 antikoerper, Tspan23 antikoerper, rds35 antikoerper, rom antikoerper, rosp1 antikoerper, tspan23 antikoerper, Rds antikoerper, zgc:56548 antikoerper, zgc:73336 antikoerper, zgc:77401 antikoerper, retinal outer segment membrane protein 1 antikoerper, rod outer segment membrane protein 1 antikoerper, retinal outer segment membrane protein 1 L homeolog antikoerper, retinal outer segment membrane protein 1b antikoerper, retinal outer segment membrane protein 1a antikoerper, ROM1 antikoerper, Rom1 antikoerper, rom1.L antikoerper, rom1b antikoerper, rom1a antikoerper
- Hintergrund
- ROM1 is an integral membrane protein found in the photoreceptor disk rim of the eye. It can form homodimers or can heterodimerize with another photoreceptor, retinal degeneration slow (RDS). It is essential for disk morphogenesis, and may also function as an adhesion molecule involved in the stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. Certain defects in this gene have been associated with the degenerative eye disease retinitis pigmentosa.
- Molekulargewicht
- 37 kDa (MW of target protein)
-