In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1) Antikörper

Antigen

Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1)

Synonyme AIF, PDCD8, MGC111425, aif, pdcd8, AIFM1, PCD8, DmelCG7263, GB16024
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN634586
Menge 50 ug  (1 mg/ml)  (Varianten)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung PDCD8
Immunogen PDCD8 antibody was raised using the C terminal Of Pdcd8 corresponding to a region with amino acids VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST
Beschreibung AIFM1 (PDCD8) is a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, AIFM1 induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9.
Molekulargewicht 36 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDCD8 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Enzyme

Alternativen

Alternativen zu Antigen "Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1)", Typ "Antikörper" finden
Wirte Kaninchen (12), Maus (1)
Reaktivitäten Human (11), Maus (6), Ratte (Rattus) (6)
Applikationen Western Blot (WB) (12), Immunfluoreszenz (IF) (4), Enzyme Immunoassay (EIA) (3), ELISA (2), Immunhistochemie (IHC) (2), Immunhistochemie (Paraffinschnitte) (IHC (p)) (1), Immunpräzipitation (IP) (1)
Epitope N-Term (4), C-Term (2), internal (1)