STATH Antikörper (Middle Region)
-
- Target Alle STATH Antikörper anzeigen
- STATH (Statherin (STATH))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser STATH Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- STATH antibody was raised against the middle region of STATH
- Aufreinigung
- Affinity purified
- Immunogen
- STATH antibody was raised using the middle region of STATH corresponding to a region with amino acids MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYP
- Top Product
- Discover our top product STATH Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
STATH Blocking Peptide, catalog no. 33R-6136, is also available for use as a blocking control in assays to test for specificity of this STATH antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STATH antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STATH (Statherin (STATH))
- Andere Bezeichnung
- STATH (STATH Produkte)
- Synonyme
- STR antikoerper, statherin antikoerper, STATH antikoerper
- Hintergrund
- STATH is a salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface.
- Molekulargewicht
- 7 kDa (MW of target protein)
-