ELAVL4 Antikörper (N-Term)

Produktnummer ABIN633409

Produktdetails anti-ELAVL4 Antikörper

Target: ELAVL4 (ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like 4 (Hu Antigen D) (ELAVL4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ELAVL4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ELAVL4 antibody was raised against the N terminal of ELAVL4

Aufreinigung: Affinity purified

Immunogen: ELAVL4 antibody was raised using the N terminal of ELAVL4 corresponding to a region with amino acids MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ELAVL4 Blocking Peptide, catalog no. 33R-6346, is also available for use as a blocking control in assays to test for specificity of this ELAVL4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELAVL4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ELAVL4

Target: ELAVL4 (ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like 4 (Hu Antigen D) (ELAVL4))

Andere Bezeichnung: ELAVL4 (ELAVL4 Produkte)

Synonyme: HUD antikoerper, PNEM antikoerper, HuD antikoerper, RGD1561943 antikoerper, r-HuD antikoerper, elrd antikoerper, hud antikoerper, wu:fc24h01 antikoerper, Elav antikoerper, Hud antikoerper, elrD antikoerper, elrD1 antikoerper, elrD2 antikoerper, ELAV-like protein 4 antikoerper, ELAV like RNA binding protein 4 antikoerper, ELAV like neuron-specific RNA binding protein 4 antikoerper, ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) antikoerper, ELAV like neuron-specific RNA binding protein 4 L homeolog antikoerper, LOC100282339 antikoerper, LOC100284149 antikoerper, ELAVL4 antikoerper, Elavl4 antikoerper, elavl4 antikoerper, elavl4.L antikoerper

Hintergrund: ELAVL4 may play a role in neuron-specific RNA processing. ELAVL4 protects CDKN1A mRNA from decay by binding to its 3'-UTR By similarity. ELAVL4 binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA.

Molekulargewicht: 42 kDa (MW of target protein)