PRPF4 Antikörper
-
- Target Alle PRPF4 Antikörper anzeigen
- PRPF4 (PRP4 Pre-mRNA Processing Factor 4 Homolog (PRPF4))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRPF4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PRPF4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPIT
- Top Product
- Discover our top product PRPF4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRPF4 Blocking Peptide, catalog no. 33R-2784, is also available for use as a blocking control in assays to test for specificity of this PRPF4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRPF4 (PRP4 Pre-mRNA Processing Factor 4 Homolog (PRPF4))
- Andere Bezeichnung
- PRPF4 (PRPF4 Produkte)
- Synonyme
- zgc:65943 antikoerper, mg:ab03a02 antikoerper, GB19235 antikoerper, DDBDRAFT_0187564 antikoerper, DDBDRAFT_0233058 antikoerper, DDB_0187564 antikoerper, DDB_0233058 antikoerper, HPRP4 antikoerper, HPRP4P antikoerper, PRP4 antikoerper, Prp4p antikoerper, SNRNP60 antikoerper, 1600015H11Rik antikoerper, AI874830 antikoerper, AW047464 antikoerper, bN189G18.1 antikoerper, pre-mRNA processing factor 4 antikoerper, PRP4 pre-mRNA processing factor 4 homolog (yeast) antikoerper, pre-mRNA processing factor 4 L homeolog antikoerper, U4/U6 small nuclear ribonucleoprotein Prp4 antikoerper, U4/U6 small nuclear ribonucleoprotein antikoerper, Prpf4 antikoerper, prpf4 antikoerper, prpf4.L antikoerper, PRPF4 antikoerper, LOC409689 antikoerper
- Hintergrund
- The removal of introns from nuclear pre-mRNAs occurs on complexes called spliceosomes, which are made up of 4 small nuclear ribonucleoprotein (snRNP) particles and an undefined number of transiently associated splicing factors.
- Molekulargewicht
- 58 kDa (MW of target protein)
-