RECQL5 Antikörper (Middle Region)

Produktnummer ABIN633185

Produktdetails anti-RECQL5 Antikörper

Target: RECQL5 (RecQ Protein-Like 5 (RECQL5))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RECQL5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RecQL5 antibody was raised against the middle region of RECQL5

Aufreinigung: Affinity purified

Immunogen: RecQL5 antibody was raised using the middle region of RECQL5 corresponding to a region with amino acids CDHCQNPTAVRRRLEALERSSSWSKTCIGPSQGNGFDPELYEGGRKGYGD

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RecQL5 Blocking Peptide, catalog no. 33R-1661, is also available for use as a blocking control in assays to test for specificity of this RecQL5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RECQL5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RECQL5

Target: RECQL5 (RecQ Protein-Like 5 (RECQL5))

Andere Bezeichnung: RecQL5 (RECQL5 Produkte)

Synonyme: RecQ5 antikoerper, DKFZp459N0627 antikoerper, recq5 antikoerper, RECQ5 antikoerper, Recq5b antikoerper, Recql5b antikoerper, RecQ like helicase 5 antikoerper, RecQ helicase-like 5 antikoerper, ATP-dependent DNA helicase Q5 antikoerper, RecQ protein-like 5 antikoerper, RECQL5 antikoerper, recql5 antikoerper, LOC100544199 antikoerper, Recql5 antikoerper

Hintergrund: RECQL5 may have an important role in DNA metabolism.

Molekulargewicht: 109 kDa (MW of target protein)