RECQL5 Antikörper (Middle Region)
-
- Target Alle RECQL5 Antikörper anzeigen
- RECQL5 (RecQ Protein-Like 5 (RECQL5))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RECQL5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RecQL5 antibody was raised against the middle region of RECQL5
- Aufreinigung
- Affinity purified
- Immunogen
- RecQL5 antibody was raised using the middle region of RECQL5 corresponding to a region with amino acids CDHCQNPTAVRRRLEALERSSSWSKTCIGPSQGNGFDPELYEGGRKGYGD
- Top Product
- Discover our top product RECQL5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RecQL5 Blocking Peptide, catalog no. 33R-1661, is also available for use as a blocking control in assays to test for specificity of this RecQL5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RECQL5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RECQL5 (RecQ Protein-Like 5 (RECQL5))
- Andere Bezeichnung
- RecQL5 (RECQL5 Produkte)
- Synonyme
- RecQ5 antikoerper, DKFZp459N0627 antikoerper, recq5 antikoerper, RECQ5 antikoerper, Recq5b antikoerper, Recql5b antikoerper, RecQ like helicase 5 antikoerper, RecQ helicase-like 5 antikoerper, ATP-dependent DNA helicase Q5 antikoerper, RecQ protein-like 5 antikoerper, RECQL5 antikoerper, recql5 antikoerper, LOC100544199 antikoerper, Recql5 antikoerper
- Hintergrund
- RECQL5 may have an important role in DNA metabolism.
- Molekulargewicht
- 109 kDa (MW of target protein)
-