PREP Antikörper (Middle Region)
-
- Target Alle PREP Antikörper anzeigen
- PREP (Prolyl Endopeptidase (PREP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PREP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PREP antibody was raised against the middle region of PREP
- Aufreinigung
- Affinity purified
- Immunogen
- PREP antibody was raised using the middle region of PREP corresponding to a region with amino acids LHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDM
- Top Product
- Discover our top product PREP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PREP Blocking Peptide, catalog no. 33R-5028, is also available for use as a blocking control in assays to test for specificity of this PREP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PREP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PREP (Prolyl Endopeptidase (PREP))
- Andere Bezeichnung
- PREP (PREP Produkte)
- Synonyme
- PE antikoerper, PEP antikoerper, AI047692 antikoerper, AI450383 antikoerper, D10Wsu136e antikoerper, Pop antikoerper, rPop antikoerper, im:7140031 antikoerper, zgc:110670 antikoerper, prolyl endopeptidase antikoerper, Prolyl endopeptidase antikoerper, RB12337 antikoerper, AM1_4884 antikoerper, ppce antikoerper, PREP antikoerper, Prep antikoerper, prep antikoerper
- Hintergrund
- PREP is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long.
- Molekulargewicht
- 81 kDa (MW of target protein)
-