HDDC3 Antikörper (Middle Region)

Produktnummer ABIN632847

Produktdetails anti-HDDC3 Antikörper

Target: HDDC3 (HD Domain Containing 3 (HDDC3))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HDDC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HDDC3 antibody was raised against the middle region of HDDC3

Aufreinigung: Affinity purified

Immunogen: HDDC3 antibody was raised using the middle region of HDDC3 corresponding to a region with amino acids TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HDDC3 Blocking Peptide, catalog no. 33R-9007, is also available for use as a blocking control in assays to test for specificity of this HDDC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDDC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HDDC3

Target: HDDC3 (HD Domain Containing 3 (HDDC3))

Andere Bezeichnung: HDDC3 (HDDC3 Produkte)

Synonyme: MESH1 antikoerper, zgc:110184 antikoerper, 1110033O09Rik antikoerper, C86475 antikoerper, RGD1311839 antikoerper, HD domain containing 3 antikoerper, HD domain containing 3 S homeolog antikoerper, hddc3 antikoerper, HDDC3 antikoerper, hddc3.S antikoerper, Hddc3 antikoerper

Hintergrund: The function of HDDC3 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 16 kDa (MW of target protein)