C17orf75 Antikörper (Middle Region)
-
- Target Alle C17orf75 Antikörper anzeigen
- C17orf75 (Chromosome 17 Open Reading Frame 75 (C17orf75))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C17orf75 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C17 orf75 antibody was raised against the middle region of C17 rf75
- Aufreinigung
- Affinity purified
- Immunogen
- C17 orf75 antibody was raised using the middle region of C17 rf75 corresponding to a region with amino acids KLKAIQDTNNLKRFIRQAEMNHYALFKCYMFLKNCGSGDILLKIVKVEHE
- Top Product
- Discover our top product C17orf75 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C17orf75 Blocking Peptide, catalog no. 33R-4513, is also available for use as a blocking control in assays to test for specificity of this C17orf75 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf75 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C17orf75 (Chromosome 17 Open Reading Frame 75 (C17orf75))
- Andere Bezeichnung
- C17orf75 (C17orf75 Produkte)
- Synonyme
- NJMU-R1 antikoerper, C17orf75 antikoerper, DKFZp469B234 antikoerper, chromosome 18 C17orf75 homolog antikoerper, chromosome 17 open reading frame 75 L homeolog antikoerper, chromosome 17 open reading frame, human C17orf75 antikoerper, chromosome 17 open reading frame 75 antikoerper, RIKEN cDNA 5730455P16 gene antikoerper, C18H17orf75 antikoerper, c17orf75.L antikoerper, C17H17orf75 antikoerper, C17orf75 antikoerper, 5730455P16Rik antikoerper
- Hintergrund
- The C17orf75 may have a role in spermatogenesis.
- Molekulargewicht
- 44 kDa (MW of target protein)
-