IDI1 Antikörper (Middle Region)
-
- Target Alle IDI1 Antikörper anzeigen
- IDI1 (Isopentenyl-Diphosphate delta Isomerase 1 (IDI1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IDI1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IDI1 antibody was raised against the middle region of IDI1
- Aufreinigung
- Affinity purified
- Immunogen
- IDI1 antibody was raised using the middle region of IDI1 corresponding to a region with amino acids PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA
- Top Product
- Discover our top product IDI1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IDI1 Blocking Peptide, catalog no. 33R-7208, is also available for use as a blocking control in assays to test for specificity of this IDI1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDI1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IDI1 (Isopentenyl-Diphosphate delta Isomerase 1 (IDI1))
- Andere Bezeichnung
- IDI1 (IDI1 Produkte)
- Synonyme
- zgc:114138 antikoerper, 4832416K17Rik antikoerper, ipp1 antikoerper, ippl1 antikoerper, IPP1 antikoerper, IPPI1 antikoerper, isopentenyl-diphosphate delta isomerase 1 antikoerper, isopentenyl-diphosphate delta isomerase antikoerper, isopentenyl-diphosphate delta isomerase 1 L homeolog antikoerper, idi1 antikoerper, Idi1 antikoerper, idi1.L antikoerper, IDI1 antikoerper
- Hintergrund
- IDI1 is a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity.
- Molekulargewicht
- 32 kDa (MW of target protein)
-