LYPLA2 Antikörper (N-Term)

Produktnummer ABIN632189

Produktdetails anti-LYPLA2 Antikörper

Target: LYPLA2 (Lysophospholipase II (LYPLA2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LYPLA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LYPLA2 antibody was raised against the N terminal of LYPLA2

Aufreinigung: Affinity purified

Immunogen: LYPLA2 antibody was raised using the N terminal of LYPLA2 corresponding to a region with amino acids MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LYPLA2 Blocking Peptide, catalog no. 33R-5812, is also available for use as a blocking control in assays to test for specificity of this LYPLA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPLA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LYPLA2

Target: LYPLA2 (Lysophospholipase II (LYPLA2))

Andere Bezeichnung: LYPLA2 (LYPLA2 Produkte)

Synonyme: APT-2 antikoerper, DJ886K2.4 antikoerper, LysoII antikoerper, MGC52664 antikoerper, MGC75683 antikoerper, LYPLA2P1 antikoerper, lysophospholipase II antikoerper, lysophospholipase 2 antikoerper, lysophospholipase II S homeolog antikoerper, LYPLA2 antikoerper, Lypla2 antikoerper, lypla2.S antikoerper, lypla2 antikoerper

Hintergrund: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.

Molekulargewicht: 25 kDa (MW of target protein)