PDS5B Antikörper

Produktnummer ABIN631437

Produktdetails anti-PDS5B Antikörper

Target: PDS5B (PDS5, Regulator of Cohesion Maintenance, Homolog B (PDS5B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDS5B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PDS5 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDS5B Blocking Peptide, catalog no. 33R-1917, is also available for use as a blocking control in assays to test for specificity of this PDS5B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDS0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDS5B

Target: PDS5B (PDS5, Regulator of Cohesion Maintenance, Homolog B (PDS5B))

Andere Bezeichnung: PDS5B (PDS5B Produkte)

Synonyme: APRIN antikoerper, AS3 antikoerper, CG008 antikoerper, Aprin antikoerper, as3 antikoerper, aprin antikoerper, AI646570 antikoerper, AW212954 antikoerper, mKIAA0979 antikoerper, pds5b antikoerper, PDS5 cohesin associated factor B antikoerper, PDS5 cohesin associated factor B L homeolog antikoerper, PDS5B antikoerper, Pds5b antikoerper, pds5b antikoerper, pds5b.L antikoerper

Hintergrund: PDS5B plays a role in androgen-induced proliferative arrest in prostate cells. It is required for maintenance of sister chromatid cohesion during mitosis. Defects in PDS5B may be the cause of some cancers including esophageal cancer.

Molekulargewicht: 159 kDa (MW of target protein)