RUFY1 Antikörper (C-Term)

Produktnummer ABIN631310

Produktdetails anti-RUFY1 Antikörper

Target: RUFY1 (RUN and FYVE Domain Containing 1 (RUFY1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RUFY1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RUFY1 antibody was raised against the C terminal of RUFY1

Aufreinigung: Affinity purified

Immunogen: RUFY1 antibody was raised using the C terminal of RUFY1 corresponding to a region with amino acids QCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RUFY1 Blocking Peptide, catalog no. 33R-7487, is also available for use as a blocking control in assays to test for specificity of this RUFY1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RUFY1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RUFY1

Target: RUFY1 (RUN and FYVE Domain Containing 1 (RUFY1))

Andere Bezeichnung: RUFY1 (RUFY1 Produkte)

Synonyme: RABIP4 antikoerper, ZFYVE12 antikoerper, 3000002E04Rik antikoerper, Rabip4 antikoerper, rabip4 antikoerper, zfyve12 antikoerper, RUN and FYVE domain containing 1 antikoerper, RUN and FYVE domain containing 1 L homeolog antikoerper, RUFY1 antikoerper, Rufy1 antikoerper, rufy1 antikoerper, rufy1.L antikoerper

Hintergrund: RUFY1 contains 1 FYVE-type zinc finger and 1 RUN domain. It binds phospholipid vesicles containing phosphatidylinositol 3-phosphate and participates in early endosomal trafficking.

Molekulargewicht: 69 kDa (MW of target protein)