PRKACB Antikörper (Middle Region)

Produktnummer ABIN631277

Der Kaninchen Polyklonal anti-PRKACB Antikörper wird verwendet zum Nachweis von PRKACB in Proben von Human, Ratte und Maus. Er wurde validiert für WB.

Kurzübersicht für PRKACB Antikörper (Middle Region) (ABIN631277)

Target: PRKACB (Protein Kinase, CAMP Dependent, Catalytic, beta (PRKACB))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRKACB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PRKACB Antikörper

Bindungsspezifität: Middle Region

Spezifität: PRKACB antibody was raised against the middle region of PRKACB

Aufreinigung: Affinity purified

Immunogen: PRKACB antibody was raised using the middle region of PRKACB corresponding to a region with amino acids NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRKACB Blocking Peptide, (ABIN5615553), is also available for use as a blocking control in assays to test for specificity of this PRKACB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKACB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRKACB

Target: PRKACB (Protein Kinase, CAMP Dependent, Catalytic, beta (PRKACB))

Andere Bezeichnung: PRKACB

Hintergrund: CAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: AMPK Signaling, Hedgehog Signalweg, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction, M Phase, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma, Lipid Metabolism