KLC3 Antikörper (Middle Region)
-
- Target Alle KLC3 Antikörper anzeigen
- KLC3 (Kinesin Light Chain 3 (KLC3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KLC3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KLC3 antibody was raised against the middle region of KLC3
- Aufreinigung
- Affinity purified
- Immunogen
- KLC3 antibody was raised using the middle region of KLC3 corresponding to a region with amino acids LLCQNQGKFEDVERHYARALSIYEALGGPHDPNVAKTKNNLASAYLKQNK
- Top Product
- Discover our top product KLC3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KLC3 Blocking Peptide, catalog no. 33R-5120, is also available for use as a blocking control in assays to test for specificity of this KLC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLC3 (Kinesin Light Chain 3 (KLC3))
- Andere Bezeichnung
- KLC3 (KLC3 Produkte)
- Synonyme
- wu:fk22d07 antikoerper, zgc:153164 antikoerper, KLC2 antikoerper, KLC2L antikoerper, KLCt antikoerper, KNS2B antikoerper, BC017147 antikoerper, Klct antikoerper, kinesin light chain 3 antikoerper, KLC3 antikoerper, klc3 antikoerper, PTRG_03762 antikoerper, PTRG_11380 antikoerper, PTRG_11942 antikoerper, Klc3 antikoerper
- Hintergrund
- KLC3 is a member of the kinesin light chain gene family. Kinesins are molecular motors involved in the transport of cargo along microtubules, and are composed of two kinesin heavy chain (KHC) and two kinesin light chain (KLC) molecules. KLCs are thought to typically be involved in binding cargo and regulating kinesin activity. In the rat, a protein similar to this gene product is expressed in post-meiotic spermatids, where it associates with structural components of sperm tails and mitochondria.
- Molekulargewicht
- 55 kDa (MW of target protein)
-