PDK2 Antikörper (Middle Region)

Produktnummer ABIN631027

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PDK2 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für PDK2 Antikörper (Middle Region) (ABIN631027)

Target: PDK2 (Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDK2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PDK2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PDK2 antibody was raised against the middle region of PDK2

Aufreinigung: Affinity purified

Immunogen: PDK2 antibody was raised using the middle region of PDK2 corresponding to a region with amino acids ELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDK2 Blocking Peptide, (ABIN937927), is also available for use as a blocking control in assays to test for specificity of this PDK2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDK2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDK2

Target: PDK2 (Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2))

Andere Bezeichnung: PDK2

Hintergrund: PDK2 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: PI3K-Akt Signalweg, RTK Signalweg, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Warburg Effekt