MATN2 Antikörper (Middle Region)
-
- Target Alle MATN2 Antikörper anzeigen
- MATN2 (Matrilin 2 (MATN2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MATN2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Matrilin 2 antibody was raised against the middle region of MATN2
- Aufreinigung
- Affinity purified
- Immunogen
- Matrilin 2 antibody was raised using the middle region of MATN2 corresponding to a region with amino acids AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED
- Top Product
- Discover our top product MATN2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Matrilin 2 Blocking Peptide, catalog no. 33R-1598, is also available for use as a blocking control in assays to test for specificity of this Matrilin 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATN2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MATN2 (Matrilin 2 (MATN2))
- Andere Bezeichnung
- Matrilin 2 (MATN2 Produkte)
- Synonyme
- matn2 antikoerper, MGC53027 antikoerper, MGC76198 antikoerper, MATN2 antikoerper, DKFZp469F2020 antikoerper, Crtm2 antikoerper, matrilin-2 antikoerper, matrilin 2 L homeolog antikoerper, matrilin 2 antikoerper, matn2.L antikoerper, matn2 antikoerper, MATN2 antikoerper, Matn2 antikoerper
- Hintergrund
- MATN2 is a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined.
- Molekulargewicht
- 102 kDa (MW of target protein)
-