NAGS Antikörper (C-Term)

Produktnummer ABIN630135

Produktdetails anti-NAGS Antikörper

Target: NAGS (N-Acetylglutamate Synthase (NAGS))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NAGS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NAGS antibody was raised against the C terminal of NAGS

Aufreinigung: Purified

Immunogen: NAGS antibody was raised using the C terminal of NAGS corresponding to a region with amino acids YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NAGS Blocking Peptide, catalog no. 33R-10162, is also available for use as a blocking control in assays to test for specificity of this NAGS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAGS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NAGS

Target: NAGS (N-Acetylglutamate Synthase (NAGS))

Andere Bezeichnung: NAGS (NAGS Produkte)

Synonyme: VF0585 antikoerper, AGAS antikoerper, ARGA antikoerper, 1700120E20Rik antikoerper, argA antikoerper, RGD1565783 antikoerper, N-acetylglutamate synthase antikoerper, amino-acid acetyltransferase ArgA antikoerper, argA antikoerper, ECs3675 antikoerper, VP2371 antikoerper, Psyr_0254 antikoerper, Sde_0360 antikoerper, NAGS antikoerper, Nags antikoerper

Hintergrund: NAGS is a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG) from glutamate and acetyl coenzyme-A. NAG is a cofactor of carbamyl phosphate synthetase I (CPSI), the first enzyme of the urea cycle in mammals. Deficiencies in N-acetylglutamate synthase have been associated with hyperammonemia.

Molekulargewicht: 58 kDa (MW of target protein)