KCNA10 Antikörper (Middle Region)

Produktnummer ABIN630070

Produktdetails anti-KCNA10 Antikörper

Target: KCNA10 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNA10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: KCNA10 antibody was raised against the middle region of KCNA10

Aufreinigung: Purified

Immunogen: KCNA10 antibody was raised using the middle region of KCNA10 corresponding to a region with amino acids PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNA10 Blocking Peptide, catalog no. 33R-6970, is also available for use as a blocking control in assays to test for specificity of this KCNA10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNA10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNA10

Target: KCNA10 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10))

Andere Bezeichnung: KCNA10 (KCNA10 Produkte)

Synonyme: cKv1.2 antikoerper, Kcn1 antikoerper, Kv1.8 antikoerper, Gm1962 antikoerper, Kcna8 antikoerper, potassium voltage-gated channel subfamily A member 10 antikoerper, potassium voltage-gated channel, shaker-related subfamily, member 10 antikoerper, KCNA10 antikoerper, Kcna10 antikoerper

Hintergrund: Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Four sequence-related potassium channel genes, shaker, shaw, shab, and shal, have been identified in Drosophila, and each has been shown to have human homolog(s). KCNA10 encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP.

Molekulargewicht: 56 kDa (MW of target protein)