CPSF6 Antikörper (Middle Region)

Produktnummer ABIN630020

Produktdetails anti-CPSF6 Antikörper

Target: CPSF6 (Cleavage and Polyadenylation Specific Factor 6, 68kDa (CPSF6))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPSF6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: CPSF6 antibody was raised against the middle region of CPSF6

Aufreinigung: Purified

Immunogen: CPSF6 antibody was raised using the middle region of CPSF6 corresponding to a region with amino acids PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPP

Anwendungsinformationen

Applikationshinweise: WB: 0.3125 µg/mL, IHC: 16 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CPSF6 Blocking Peptide, catalog no. 33R-7262, is also available for use as a blocking control in assays to test for specificity of this CPSF6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPSF6

Target: CPSF6 (Cleavage and Polyadenylation Specific Factor 6, 68kDa (CPSF6))

Andere Bezeichnung: CPSF6 (CPSF6 Produkte)

Synonyme: CPSF6 antikoerper, wu:fa22f12 antikoerper, zgc:85819 antikoerper, 4733401N12Rik antikoerper, AI256641 antikoerper, CFIM antikoerper, CFIM68 antikoerper, HPBRII-4 antikoerper, HPBRII-7 antikoerper, cleavage and polyadenylation specific factor 6 antikoerper, cleavage and polyadenylation specific factor 6 S homeolog antikoerper, CPSF6 antikoerper, cpsf6.S antikoerper, cpsf6 antikoerper, Cpsf6 antikoerper

Hintergrund: CPSF6 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides.

Molekulargewicht: 61 kDa (MW of target protein)