GSTZ1 Antikörper
-
- Target Alle GSTZ1 Antikörper anzeigen
- GSTZ1 (Glutathione Transferase zeta 1 (Maleylacetoacetate Isomerase) (GSTZ1))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GSTZ1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- GSTZ1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF
- Top Product
- Discover our top product GSTZ1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GSTZ1 Blocking Peptide, catalog no. 33R-6317, is also available for use as a blocking control in assays to test for specificity of this GSTZ1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTZ1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GSTZ1 (Glutathione Transferase zeta 1 (Maleylacetoacetate Isomerase) (GSTZ1))
- Andere Bezeichnung
- GSTZ1 (GSTZ1 Produkte)
- Synonyme
- GSTZ1-1 antikoerper, MAAI antikoerper, MAI antikoerper, zgc:113898 antikoerper, zgc:92869 antikoerper, PSPTO3554 antikoerper, DDBDRAFT_0204466 antikoerper, DDBDRAFT_0231608 antikoerper, DDB_0204466 antikoerper, DDB_0231608 antikoerper, CG9362 antikoerper, Dmel\CG9362 antikoerper, gstz1 antikoerper, glutathione S-transferase zeta 1 antikoerper, glutathione transferase zeta 1 (maleylacetoacetate isomerase) antikoerper, maleylacetoacetate isomerase antikoerper, Glutathione S transferase Z1 antikoerper, glutathione S-transferase zeta 1 L homeolog antikoerper, GSTZ1 antikoerper, Gstz1 antikoerper, gstz1 antikoerper, maiA antikoerper, hmgC antikoerper, Patl_1448 antikoerper, Pnap_2807 antikoerper, Bind_0562 antikoerper, Bphyt_0577 antikoerper, Dtpsy_1678 antikoerper, Hbal_2638 antikoerper, mai antikoerper, BC1002_0299 antikoerper, Fbal_2576 antikoerper, Mesop_3937 antikoerper, GstZ1 antikoerper, gstz1.L antikoerper
- Hintergrund
- GSTZ1 is a member of the glutathione S-transferase (GSTs) super-family which are important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia.
- Molekulargewicht
- 24 kDa (MW of target protein)
-