METTL1 Antikörper (Middle Region)

Produktnummer ABIN629728

Produktdetails anti-METTL1 Antikörper

Target: METTL1 (Methyltransferase Like 1 (METTL1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser METTL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: METTL1 antibody was raised against the middle region of METTL1

Aufreinigung: Purified

Immunogen: METTL1 antibody was raised using the middle region of METTL1 corresponding to a region with amino acids KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

METTL1 Blocking Peptide, catalog no. 33R-4401, is also available for use as a blocking control in assays to test for specificity of this METTL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu METTL1

Target: METTL1 (Methyltransferase Like 1 (METTL1))

Andere Bezeichnung: METTL1 (METTL1 Produkte)

Synonyme: Dmel\\CG4045 antikoerper, EG:22E5.4 antikoerper, C12orf1 antikoerper, TRM8 antikoerper, TRMT8 antikoerper, YDL201w antikoerper, 2810012D02Rik antikoerper, CG4045 gene product from transcript CG4045-RA antikoerper, methyltransferase like 1 antikoerper, methyltransferase like 1 L homeolog antikoerper, tRNA (guanine46-N7)-methyltransferase antikoerper, tRNA (guanine-N(1)-)-methyltransferase antikoerper, tRNA (guanine-N7-)-methyltransferase antikoerper, CG4045 antikoerper, METTL1 antikoerper, Mettl1 antikoerper, mettl1.L antikoerper, CAALFM_C404810CA antikoerper, LOC100280508 antikoerper, LOC732983 antikoerper

Hintergrund: METTL1 contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation.

Molekulargewicht: 34 kDa (MW of target protein)