ANKRD11 Antikörper (N-Term)

Produktnummer ABIN629618

Produktdetails anti-ANKRD11 Antikörper

Target: ANKRD11 (Ankyrin Repeat Domain 11 (ANKRD11))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANKRD11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ANKRD11 antibody was raised against the N terminal of ANKRD11

Aufreinigung: Purified

Immunogen: ANKRD11 antibody was raised using the N terminal of ANKRD11 corresponding to a region with amino acids KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANKRD11 Blocking Peptide, catalog no. 33R-4627, is also available for use as a blocking control in assays to test for specificity of this ANKRD11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANKRD11

Target: ANKRD11 (Ankyrin Repeat Domain 11 (ANKRD11))

Andere Bezeichnung: ANKRD11 (ANKRD11 Produkte)

Synonyme: ANCO-1 antikoerper, ANCO1 antikoerper, LZ16 antikoerper, T13 antikoerper, 2410104C19Rik antikoerper, 3010027A04Rik antikoerper, 6330578C09Rik antikoerper, 9530048I21Rik antikoerper, AA930108 antikoerper, Gm176 antikoerper, Yod antikoerper, ANKRD11 antikoerper, wu:fc59e05 antikoerper, wu:fi04c06 antikoerper, ankyrin repeat domain 11 antikoerper, ankyrin repeat domain 11 L homeolog antikoerper, ANKRD11 antikoerper, Ankrd11 antikoerper, ankrd11.L antikoerper, ankrd11 antikoerper

Hintergrund: ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.

Molekulargewicht: 298 kDa (MW of target protein)