TFPI2 Antikörper (N-Term)
-
- Target Alle TFPI2 Antikörper anzeigen
- TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))
-
Bindungsspezifität
- AA 70-105, N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TFPI2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Tissue factor pathway inhibitor 2(TFPI2) detection. Tested with WB, IHC-P in Human,Mouse.
- Sequenz
- EGNANNFYTW EACDDACWRI EKVPKVCRLQ VSVDDQ
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Tissue factor pathway inhibitor 2(TFPI2) detection. Tested with WB, IHC-P in Human,Mouse.
Gene Name: tissue factor pathway inhibitor 2
Protein Name: Tissue factor pathway inhibitor 2 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human TFPI2 (70-105aa EGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQ).
- Isotyp
- IgG
- Top Product
- Discover our top product TFPI2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))
- Andere Bezeichnung
- TFPI2 (TFPI2 Produkte)
- Synonyme
- MGC68843 antikoerper, TFPI2 antikoerper, MGC108301 antikoerper, si:ch211-262k23.2 antikoerper, tfpi2 antikoerper, PP5 antikoerper, REF1 antikoerper, TFPI-2 antikoerper, AV000670 antikoerper, PP5/TFPI-2 antikoerper, tissue factor pathway inhibitor 2 L homeolog antikoerper, tissue factor pathway inhibitor 2 antikoerper, tfpi2.L antikoerper, TFPI2 antikoerper, tfpi2 antikoerper, Tfpi2 antikoerper
- Hintergrund
-
Tissue factor pathway inhibitor 2, also known as TFPI2, is a human gene which is located at 7q22. It is an important regulator of the extrinsic pathway of blood coagulation through its ability to inhibit factor Xa and factor VIIa-tissue factor activity. After a 22-residue signal peptide, the mature TFPI2 protein contains 213 amino acids with 18 cysteines and 2 canonical N-linked glycosylation sites. The purified recombinant TFPI2 strongly inhibited the amidolytic activities of trypsin and the factor VIIa-tissue factor complex. The latter inhibition was markedly enhanced in the presence of heparin. Mouse TFPI2 mRNA is highly expressed in developing mouse placenta, as in human. And there are also high transcript levels in adult mouse liver and kidney.
Synonyms: Tissue factor pathway inhibitor 2 | TFPI-2 | Placental protein 5 | PP5 | TFPI2 | TFPI 2 | P48307 - Gen-ID
- 7980
- UniProt
- P48307
-