MMP11 Antikörper (N-Term)

Produktnummer ABIN5518777

Produktdetails anti-MMP11 Antikörper

Target: MMP11 (Matrix Metallopeptidase 11 (Stromelysin 3) (MMP11))

Bindungsspezifität: AA 104-135, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MMP11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Stromelysin-3(MMP11) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: RWEKTDLTYR ILRFPWQLVQ EQVRQTMAEA LK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Stromelysin-3(MMP11) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: matrix metallopeptidase 11
Protein Name: Stromelysin-3

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MMP11 (104-135aa RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK), different from the related mouse and rat sequences by three amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-MMP11 Antikörper (ABIN5518777)

Zhang, Teng, Liu, Zhang, Liu: "Gene expression profile analyze the molecular mechanism of CXCR7 regulating papillary thyroid carcinoma growth and metastasis." in: Journal of experimental & clinical cancer research : CR, Vol. 34, pp. 16, (2015) (PubMed).

Details zu MMP11

Target: MMP11 (Matrix Metallopeptidase 11 (Stromelysin 3) (MMP11))

Andere Bezeichnung: MMP11 (MMP11 Produkte)

Synonyme: SL-3 antikoerper, ST3 antikoerper, STMY3 antikoerper, Stmy3 antikoerper, MMP-11 antikoerper, matrix metallopeptidase 11 antikoerper, matrix metallopeptidase 11 L homeolog antikoerper, stromelysin-3 antikoerper, MMP11 antikoerper, Mmp11 antikoerper, mmp11.L antikoerper, LOC103694874 antikoerper

Hintergrund: Stromelysin-3 (SL-3) also known as matrix metalloproteinase-11 (MMP-11) is an enzyme that in humans is encoded by the MMP11 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the enzyme encoded by this gene is activated intracellularly by furin within the constitutive secretory pathway. Also in contrast to other MMP's, this enzyme cleaves alpha 1-proteinase inhibitor but weakly degrades structural proteins of the extracellular matrix.

Synonyms: MMP-11 | Mmp11 | SL 3 | SL-3 | SL3 | ST3 | STMY3 | Stromelysin 3 | Stromelysin III | Stromelysin-3 | P24347

Gen-ID: 4320

UniProt: P24347