ANGPTL2 Antikörper (Middle Region)

Produktnummer ABIN5518733

Produktdetails anti-ANGPTL2 Antikörper

Target: ANGPTL2 (Angiopoietin-Like 2 (ANGPTL2))

Bindungsspezifität: AA 275-312, Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANGPTL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Angiopoietin-related protein 2(ANGPTL2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: WRDCLQALED GHDTSSIYLV KPENTNRLMQ VWCDQRHD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Angiopoietin-related protein 2(ANGPTL2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: angiopoietin like 2
Protein Name: Angiopoietin-related protein 2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ANGPTL2 (275-312aa WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD), different from the related mouse sequence by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ANGPTL2

Target: ANGPTL2 (Angiopoietin-Like 2 (ANGPTL2))

Andere Bezeichnung: ANGPTL2 (ANGPTL2 Produkte)

Synonyme: ARP2 antikoerper, HARP antikoerper, AI593246 antikoerper, AW260363 antikoerper, Arp2 antikoerper, ANGPTL2 antikoerper, angptl2 antikoerper, wu:fc41g02 antikoerper, arp2 antikoerper, fbnl antikoerper, harp antikoerper, angptl2a antikoerper, angiopoietin like 2 antikoerper, angiopoietin-like 2 antikoerper, angiopoietin-like 2b antikoerper, angiopoietin like 2 L homeolog antikoerper, ANGPTL2 antikoerper, Angptl2 antikoerper, angptl2b antikoerper, angptl2 antikoerper, angptl2.L antikoerper

Hintergrund: Angiopoietin-related protein 2, also known as angiopoietin-like protein 2, is a protein that in humans is encoded by the ANGPTL2 gene. Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action.

Synonyms: AI593246 | Angptl2 | Arp2 | HARP | MGC8889 | UNQ170/PRO196 | Q9UKU9

Gen-ID: 23452