SYN1 Antikörper (C-Term)
-
- Target Alle SYN1 Antikörper anzeigen
- SYN1 (Synapsin I (SYN1))
-
Bindungsspezifität
- AA 662-705, C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SYN1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Synapsin-1(SYN1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- KSQSLTNAFN LPEPAPPRPS LSQDEVKAET IRSLRKSFAS L
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Synapsin-1(SYN1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: synapsin I
Protein Name: Synapsin-1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human Synapsin I (662-705aa KSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSLRKSFASL FSD), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product SYN1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
- Target
- SYN1 (Synapsin I (SYN1))
- Andere Bezeichnung
- SYN1 (SYN1 Produkte)
- Synonyme
- SYN1a antikoerper, SYN1b antikoerper, SYNI antikoerper, Syn-1 antikoerper, SYN I antikoerper, si:dkey-90n12.3 antikoerper, synapsin I antikoerper, synapsin I L homeolog antikoerper, SYN1 antikoerper, Syn1 antikoerper, syn1.L antikoerper, syn1 antikoerper
- Hintergrund
-
Synapsin I, is the collective name for Synapsin Ia and Synapsin Ib, two nearly identical phosphoproteins that in humans are encoded by the SYN1 gene. This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family plays a role in regulation of axonogenesis and synaptogenesis. The protein encoded serves as a substrate for several different protein kinases and phosphorylation may function in the regulation of this protein in the nerve terminal. Mutations in this gene may be associated with X-linked disorders with primary neuronal degeneration such as Rett syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.
Synonyms: SYN 1 | SYN 1a | SYN1a | SYN 1b | SYN1b | SYN I | SYNI | Synapsin1 | Synapsin-1 | Synapsin 1 | SYNI | P17600 - Gen-ID
- 6853
- UniProt
- P17600
-