FABP2 Antikörper (N-Term)
-
- Target Alle FABP2 Antikörper anzeigen
- FABP2 (Fatty Acid Binding Protein 2, Intestinal (FABP2))
-
Bindungsspezifität
- AA 2-38, N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FABP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Fatty acid-binding protein, intestinal(FABP2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- AFDSTWKVDR SENYDKFMEK MGVNIVKRKL AAHDNLK
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Fatty acid-binding protein, intestinal(FABP2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: fatty acid binding protein 2, intestinal
Protein Name: Fatty acid-binding protein, intestinal - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human FABP2/I-FABP (2-38aa AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product FABP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- FABP2 (Fatty Acid Binding Protein 2, Intestinal (FABP2))
- Andere Bezeichnung
- FABP2 (FABP2 Produkte)
- Synonyme
- I-FABP antikoerper, ifabp antikoerper, zgc:92264 antikoerper, IFABP antikoerper, fabpi antikoerper, i-fabp antikoerper, fabp2-A antikoerper, FABP2 antikoerper, FABPI antikoerper, FABP antikoerper, Fabpi antikoerper, fabp2 antikoerper, fabp2a antikoerper, fatty acid binding protein 2, intestinal antikoerper, fatty acid binding protein 2 antikoerper, fatty acid binding protein 2 L homeolog antikoerper, fabp2 antikoerper, FABP2 antikoerper, Fabp2 antikoerper, fabp2.L antikoerper
- Hintergrund
-
FABP 2, Fatty acid-binding protein 2, is a protein that in humans is encoded by the FABP2 gene. Using a human cDNA probe, the gene is assigned to chromosome 4 in somatic cell hybrids. FABP 2 gene contains four exons and is an abundant cytosolic protein in small intestine epithelial cells. The FABPs belong to a multigene family with nearly twenty identified members. And FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. Also, they may be responsible in the modulation of cell growth and proliferation.
Synonyms: FABP2 | FABPI | I FABP | IFABP | I-FABP | intestinal FABP | P12104 - Gen-ID
- 2169
- UniProt
- P12104
-