UBA1 Antikörper (N-Term)
-
- Target Alle UBA1 Antikörper anzeigen
- UBA1 (Ubiquitin-Like Modifier Activating Enzyme 1 (UBA1))
-
Bindungsspezifität
- AA 102-139, N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UBA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Ubiquitin-like modifier-activating enzyme 1(UBA1) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- HDQGTAQWAD LSSQFYLREE DIGKNRAEVS QPRLAELN
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Ubiquitin-like modifier-activating enzyme 1(UBA1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: ubiquitin like modifier activating enzyme 1
Protein Name: Ubiquitin-like modifier-activating enzyme 1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human UBA1 (102-139aa HDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELN), different from the related mouse and rat sequences by one amino acid.
- Isotyp
- IgG
- Top Product
- Discover our top product UBA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- UBA1 (Ubiquitin-Like Modifier Activating Enzyme 1 (UBA1))
- Andere Bezeichnung
- UBA1 (UBA1 Produkte)
- Synonyme
- A1S9 antikoerper, A1S9T antikoerper, A1ST antikoerper, AMCX1 antikoerper, GXP1 antikoerper, POC20 antikoerper, SMAX2 antikoerper, UBA1A antikoerper, UBE1 antikoerper, UBE1X antikoerper, DDBDRAFT_0190927 antikoerper, DDBDRAFT_0220497 antikoerper, DDB_0190927 antikoerper, DDB_0220497 antikoerper, Sbx antikoerper, Ube-1 antikoerper, Ube1x antikoerper, a1s9 antikoerper, a1s9t antikoerper, a1st antikoerper, amcx1 antikoerper, gxp1 antikoerper, poc20 antikoerper, smax2 antikoerper, uba1a antikoerper, ube1 antikoerper, ube1x antikoerper, uba1 antikoerper, uba1b antikoerper, ube antikoerper, zgc:66143 antikoerper, wu:fa01e08 antikoerper, wu:fb30f01 antikoerper, wu:fi21c11 antikoerper, wu:fj14g11 antikoerper, ubiquitin like modifier activating enzyme 1 antikoerper, ubiquitin activating enzyme E1 antikoerper, Ubiquitin-conjugating enzyme E1 antikoerper, ubiquitin-like modifier activating enzyme 1 antikoerper, ubiquitin-like modifier activating enzyme 1 S homeolog antikoerper, ubiquitin-like modifier activating enzyme 1 L homeolog antikoerper, UBA1 antikoerper, uae1 antikoerper, GL50803_4083 antikoerper, GL50803_10661 antikoerper, Uba1 antikoerper, uba1.S antikoerper, uba1.L antikoerper, uba1 antikoerper, ptr3 antikoerper
- Hintergrund
-
Ubiquitin-like modifier activating enzyme 1 (UBA1) is an enzyme which in humans is encoded by the UBA1 gene. The protein encoded by this gene catalyzes the first step in ubiquitin conjugation, or ubiquitination, to mark cellular proteins for degradation. Specifically, UBA1 catalyzes the ATP-dependent adenylation of ubiquitin (Ub), thereby forming a thioester bond between the two. It also continues to participate in subsequent steps of ubiquination as a Ub carrier. UBA1 is one of only two human ubiquitin-activating enzymes (E1), the other being UBA6, and thus is largely responsible for protein ubiquitination in humans. Through its central role in ubiquitination, UBA1 has been linked to cell cycle regulation, endocytosis, signal transduction, apoptosis, DNA damage repair, and transcriptional regulation. Additionally, UBE1 helps regulate the NEDD8 pathway, thus implicating it in protein folding, as well as mitigating the depletion of ubiquitin levels during stress.
Synonyms: A1S9 antibody|A1S9 protein antibody|A1S9T and BN75 temperature sensitivity complementing antibody|A1S9T antibody|A1ST antibody|AMCX1 antibody|CFAP124 antibody|CTD-2522E6.1 antibody|GXP 1 antibody|GXP1 antibody|MGC4781 antibody|POC20 antibody|POC20 centriolar protein homolog antibody|Protein A1S9 antibody|SMAX2 antibody|Uba1 antibody|UBA1, ubiquitin-activating enzyme E1 homolog A antibody|UBA1_HUMAN antibody|UBA1A antibody|UBE 1 antibody|UBE 1X antibody|UBE1 antibody|UBE1X antibody|Ubiquitin activating enzyme E1 antibody| Ubiquitin-activating enzyme E1 antibody|Ubiquitin-like modifier-activating enzyme 1 antibody - Gen-ID
- 7317
- UniProt
- P22314
-