Aquaporin 1 Antikörper (C-Term)
-
- Target Alle Aquaporin 1 (AQP1) Antikörper anzeigen
- Aquaporin 1 (AQP1) (Aquaporin 1 (Colton Blood Group) (AQP1))
-
Bindungsspezifität
- AA 240-269, C-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Aquaporin 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Aquaporin-1(AQP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- DRVKVWTSGQ VEEYDLDADD INSRVEMKPK
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Aquaporin-1(AQP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: aquaporin 1
Protein Name: Aquaporin-1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240-269aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK), different from the related mouse and rat sequences by one amino acid.
- Isotyp
- IgG
- Top Product
- Discover our top product AQP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Effect of selective inhibition of aquaporin 1 on chemotherapy sensitivity of J82 human bladder cancer cells." in: Oncology letters, Vol. 15, Issue 3, pp. 3864-3869, (2018) (PubMed).
: "Dynamic expression and roles of sequestome‑1/p62 in LPS‑induced acute kidney injury in mice." in: Molecular medicine reports, Vol. 17, Issue 6, pp. 7618-7626, (2018) (PubMed).
: "Expression pattern of aquaporins in patients with primary nephrotic syndrome with edema." in: Molecular medicine reports, Vol. 12, Issue 4, pp. 5625-32, (2016) (PubMed).
: "Early hyperbaric oxygen therapy inhibits aquaporin 4 and adrenocorticotropic hormone expression in the pituitary gland of rabbits with blast-induced craniocerebral injury." in: Neural regeneration research, Vol. 7, Issue 22, pp. 1729-35, (2015) (PubMed).
: "Effects of dexmedetomidine on the protection of hyperoxia-induced lung injury in newborn rats." in: International journal of clinical and experimental pathology, Vol. 8, Issue 6, pp. 6466-73, (2015) (PubMed).
: "Aquaporin-1 expression and angiogenesis in rabbit chronic myocardial ischemia is decreased by acetazolamide." in: Heart and vessels, Vol. 25, Issue 3, pp. 237-47, (2010) (PubMed).
: "
-
Effect of selective inhibition of aquaporin 1 on chemotherapy sensitivity of J82 human bladder cancer cells." in: Oncology letters, Vol. 15, Issue 3, pp. 3864-3869, (2018) (PubMed).
-
- Target
- Aquaporin 1 (AQP1) (Aquaporin 1 (Colton Blood Group) (AQP1))
- Andere Bezeichnung
- AQP1 (AQP1 Produkte)
- Synonyme
- fj33g04 antikoerper, zgc:85890 antikoerper, wu:fj33g04 antikoerper, AQP1 antikoerper, CHIP28 antikoerper, AQP-CHIP antikoerper, CO antikoerper, AQP-1 antikoerper, CHIP29 antikoerper, aquaporin 1a (Colton blood group), tandem duplicate 1 antikoerper, aquaporin 1 antikoerper, aquaporin 1 (Colton blood group) antikoerper, aqp1a.1 antikoerper, AQP1 antikoerper, Aqp1 antikoerper
- Hintergrund
-
Aquaporin 1 is a 28-kD integral protein thought at first to be a breakdown product of the Rh polypeptide but was later shown to be a unique molecule that is abundant in erythrocytes and renal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.
Synonyms: AQP 1 antibody|AQP CHIP antibody|AQP-1 antibody|AQP1 antibody|AQP1_HUMAN antibody|Aquaporin CHIP antibody|Aquaporin-1 antibody|Aquaporin-CHIP antibody|Aquaporin1 antibody|Channel forming integral protein 28 kDa antibody|Channel like integral membrane protein 28 kDa antibody|CHIP 28 antibody| CHIP28 antibody|CO antibody|Colton blood group antibody|Growth factor induced delayed early response protein antibody|MGC26324 antibody|Urine water channel antibody|Water channel protein CHIP 29 antibody|Water channel protein CHIP29 antibody|Water channel protein for red blood cells and kidney proximal tubule antibody - Gen-ID
- 358
- UniProt
- P29972
- Pathways
- Hormone Transport
-